KEGG   Methylobacterium extorquens CM4: Mchl_1812Help
Entry
Mchl_1812         CDS       T00809                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch02020  Two-component system
mch02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mchl_1812
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mchl_1812
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mchl_1812
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Mchl_1812
Two-component system [BR:mch02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mchl_1812
Bacterial motility proteins [BR:mch02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mchl_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ACK82675
UniProt: B7KUH0
Position
1866776..1867924
Genome map
AA seq 382 aa AA seqDB search
MSAFPAVAHAPAARSPIKVLVADDSAVVRGLVSRWLGEAGHEVVATAPNGRAAVDALARC
NPDVVLLDIEMPELDGIQALPLMLAKQPGIQVVMMSTLTQRNADVSLRCLALGAVDYIPK
PESNRGVTTSDGFRNDLIERIRVFGAARARRRPGPTVVESASSAAPAAPAVSRLSGTVTL
RPKPRTVVPPRALLIGSSTGGPRAVGEVLEKIGAATLRRLPVLIVQHMPPVFTAVFAEHL
GARIGLPAAEGKADERLQPGRIYVAPGGRHMRLAGSAAETIIRLDDGPPVNFCRPAVDVM
FLDAAALYGGATLSVILTGMGSDGTAGSRALVEAGGILLAQDEATSTVWGMPGSVAKAGL
CHAVLPLPEIGPALRNAIAERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcattcccggccgtcgcacacgctccggcggcgcgcagcccgatcaaggtgctg
gtcgccgacgactcggctgtggtgcgcgggctcgtctcgcgctggctcggcgaggcgggc
cacgaggtggtcgccaccgcgcccaacggccgcgccgccgtggacgcgctggcccgctgc
aaccccgacgtggtgctcctcgacatcgagatgccggaactcgacggcatccaggccctg
cccctgatgctcgccaagcagccggggatccaggtcgtgatgatgtcgacgctgacccag
cgcaacgccgacgtctccctgcgctgcctcgcgctcggcgcggtcgattacatccccaag
cccgagagcaaccgcggcgtcaccacctcggacggcttccgcaacgacctgatcgagcgc
atccgggtgttcggagccgcccgcgcccggcgtcggccggggccgaccgtggtcgaatcc
gcctcctccgcggcgcccgccgcaccggccgtctcgcgcctgtcgggcacggtgacgctg
cggccgaagccgcgcaccgtggtgccgccgcgcgccctgctgatcggctcctcgaccggc
ggcccgcgggcggtcggcgaggtgctggagaagatcggcgcggccacgctccggcgcctg
ccggtgctgatcgtgcagcacatgccgccggtcttcaccgccgtcttcgccgaacatctc
ggcgcccggatcgggttgccggcggccgagggcaaggccgacgagcggttgcagcccggc
cgcatctacgtcgccccgggcgggcgccacatgcggctcgcaggctccgcggccgagacc
atcatccgcctcgacgacgggccaccagtgaacttctgccgcccggcggtggacgtgatg
ttcctcgatgccgccgcgctctacggcggggcgacgctgagcgtcatcctcaccggcatg
ggctcggacggcacggcgggctcccgcgcgctggtcgaggccggcggcatcctgctcgct
caggacgaagccaccagcacggtctggggcatgcccggcagcgtcgccaaagcgggtctg
tgccacgccgtcctcccgctccccgagatcggaccggctctgcgcaacgcgatcgcggag
cgggtttga

DBGET integrated database retrieval system