KEGG   Methylobacterium extorquens CM4: Mchl_1929Help
Entry
Mchl_1929         CDS       T00809                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mchl_1929
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mchl_1929
  Amino acid metabolism
   00310 Lysine degradation
    Mchl_1929
Enzymes [BR:mch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mchl_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1994374..1995702
Genome map
AA seq 442 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAETKTQSREEKGESKPAKEDAPA
QESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDMLAAI
DRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQETAAMLT
TFNDVDMGAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLVY
KNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQGGTFTI
TNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIVDGKE
AVTFLVRVKEALEDPARLVLDL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgacatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaagaagcccggcgacacggtggccgccgacgagcccctcgtggaactcgag
accgacaaggtcacgctcgaagtgaacgccccggccgcgggcgaactcggcgagatcttg
gtcaaggacggcgagacggtggagcccggcgcggtgctcggctcgatcgtcgagggcggc
aagggttcaggaaaatcggatgcgaagcccgctccgaagagcgccgagccggccgagacc
aagacgcaatctcgcgaagagaagggcgagagcaagcccgccaaggaagacgcgcccgcc
caggaatcctcggcctcctacggcagccacggcgacgccccgcccacggacgggcgcccg
gccgatgacagcggcccggcggtggccaagctcgcccgcgaatccggcatcgacccggcg
agcctcaacggcagcggcaaggacggccgcgtgaccaagggcgacatgctcgccgcgatc
gacaggaacggccagaaggctccggctcaggaagcccggagcgagacgaaggcccccccg
ccgcgcgccccctccgcgccggacgacgccgcgcgcgaggagcgcgtgcggatgaccaag
ctgcgccagaccatcgccaagcgcctcaagagcgcccaggaaacggcggcgatgctgacc
acgttcaacgacgtggacatgggcgcggtgatggcgatgcgctcgcagtacaaggacatc
ttcgagaagaagcacgggacgaagctcggcttcatgggcttcttcaccaaggcagtgatc
ggcgccctcaaggacgtgccggcggtcaatgccgagatcgacgggcaggatctcgtctac
aagaactactaccatatcggcatcgcggtcggcaccgataagggcctcgtcgtgccggtg
gtgcgcgacgccgacgacctctcgatcgccggaatcgagaagaagatctcgggcttcggc
aagaaggcccgcgagggcaagctctccatcgacgagatgcagggcggcaccttcaccatc
accaacggcggcatctacggctcgctgatgtcgaccccgatcctcaacgcgccgcaatcg
ggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcaacggcaagatcgag
gcgcggccgatgatgtatctggcgctctcctacgatcaccgcatcgtcgacgggaaggag
gccgtgaccttcctcgttcgcgtcaaggaagccttggaggatccggcccgcctcgtgctg
gacctgtaa

DBGET integrated database retrieval system