KEGG   Methylobacterium extorquens CM4: Mchl_2216Help
Entry
Mchl_2216         CDS       T00809                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mch  Methylobacterium extorquens CM4
Brite
Enzymes [BR:mch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Mchl_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2319695..2320720
Genome map
AA seq 341 aa AA seqDB search
MTEPTQSGPFPAGPVLITGASGFLGAALVDVFRAAGFRVRITVRASSPRTNLIWPDVEIV
EADMRDRAAVASAMRGQRYLVHAAADYRLWAPDMEEIVRTNRDGTRILMEEALKAGVERI
VYTSSVATIKPHDDSTPADETRPLTPETAIGAYKRSKVVAERVVDEMVARDGLPAVIVNP
STPIGPRDVKPTPTGRIILDAAQGKIPAFVDTGLNLAHVDDVAAGHLLALRKGRIGEHYI
LGGEDVMLAQMLADIAAIVGRKAPTTRLPYAVIYPIAFISEQIARVTGKAPLATIDGVRM
SKYRMFFSDAKARAELGYSARPYRRGLEDAIAWFRQAGYMK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccgacccaaagcggcccgttcccagcggggccggtgttgatcaccggtgcc
agcggcttcctcggagccgccctggtggacgtcttccgcgcggccggcttccgcgtgcgc
atcaccgtgcgcgcctcctcgccccgcaccaacctgatctggcccgatgtcgagatcgtc
gaggccgacatgcgcgaccgggcggcggtggcgagcgccatgcgcggccagcgctacctc
gtccacgccgcggccgattaccggctctgggcgccggacatggaggagatcgtccgcacc
aaccgcgacggcacgcgtatcctgatggaggaggcgctcaaggctggcgtggagcggatc
gtctacacatcgagcgtcgcgaccatcaaaccgcacgacgacagcacccccgccgacgag
acccggccactgacgccggagaccgccatcggcgcctacaagcgcagtaaggtcgtggcc
gagcgcgtggtcgacgagatggtggcccgtgacggcctgcccgccgtcatcgtgaacccc
tcgaccccgatcggcccccgcgacgtgaagccgacgccgaccggccgcatcatcctcgac
gcggcgcagggcaagattccggccttcgtcgataccggcctcaacctcgcccatgtcgac
gacgtggctgcgggccatttgctggccctgcgcaagggccggatcggcgagcactacatc
ctcggcggcgaggatgtgatgctggcgcaaatgctcgccgacatcgccgccatcgtcggc
cgcaaggcgccgacgacgcggctgccctacgcggtgatctacccgatcgccttcatctcc
gagcagatcgcgcgggtgaccggcaaggcgccgctggccaccatcgacggcgtgcgcatg
tcgaagtaccggatgttcttctccgacgccaaggcacgggcggaactcggctattccgcg
cggccctaccgccggggccttgaggatgccatcgcgtggttccgtcaggcggggtacatg
aaatga

DBGET integrated database retrieval system