KEGG   Methylobacterium extorquens CM4: Mchl_2636Help
Entry
Mchl_2636         CDS       T00809                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mch00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2770598..2771605
Genome map
AA seq 335 aa AA seqDB search
MVLTRFPRVALTDGPTPIRSLDRLSTHLGPDLNGVRLFVKRDDIGPVGLGGNKLRKLEFL
LGQALAERADTVITVGALQSNHARLTAASAARMGLACELFLTRSVPREDADYTANGNRLL
QDLFGAHVHLLPGEADSLAQAEARAEELRAEGRRVHVFPSGGSSPLGCLGYAACAAEILE
QAANLGLAFARIVVPNGSSGTHAGLAAGLAAAGRDPHLAQSYTVLAPEPEATAATLARAR
DTLALIDASQTLSDDAILVDGAHRGPGYGIPTEGMREAVRLMARTEGLLLDPVYSGKAFA
GLLHDVRAGLYERGAAVLFVMTGGVPGLFAYRSEF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggttctcacccgcttcccccgtgtcgcgctcaccgacgggccgacgccgatccgctcc
ctcgaccgtctctcgacccatctcgggcccgatctgaacggcgtccgcctgttcgtgaag
cgcgacgacatcggcccggtgggtttgggcggcaacaagctgcgcaagctcgaattcctg
ctcggtcaggcgctggcggagcgggccgacacggtgatcaccgtcggtgcgctgcaatcg
aaccacgcccggctcaccgccgcctccgccgcgcggatggggctcgcctgcgagctgttc
ctcacccgcagcgtcccgcgggaggacgccgactacacagccaacggcaaccggctgttg
caggatctgttcggcgcccatgtgcacctgctgccgggcgaggcggattcgctggcgcag
gccgaggcgcgggcggaggagttgagggcggaggggcggcgcgtccacgtcttcccctcc
ggcgggtcgagcccgctcggctgtctcggctacgcggcgtgcgccgccgagattttggag
caggcggccaatctcggcctcgccttcgcccgcatcgtcgtgccgaacggcagctccggc
acccatgcggggctcgccgccggtctcgccgccgccggccgcgacccgcatctggcccaa
tcctacacggtgctcgcccccgagcccgaggcgacggccgcgacgttggccagggcccgc
gacaccctcgcgctgatcgatgccagtcagacgctctccgatgatgccattctcgtggac
ggtgcccatcgcgggccgggctacggcatcccgaccgagggcatgcgcgaggcggtgcgg
ctgatggcccgcacggaaggactgctgctcgaccccgtctacagcggcaaggcgttcgcc
gggctcctccacgacgtgcgggccggcctgtacgagcgcggcgcggcggtgctgttcgtg
atgaccggcggcgtgccggggctgttcgcctatcggagcgagttttag

DBGET integrated database retrieval system