KEGG   Methylobacterium extorquens CM4: Mchl_2728Help
Entry
Mchl_2728         CDS       T00809                                 

Definition
magnesium chelatase ATPase I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mchl_2728
Enzymes [BR:mch01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mchl_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2866762..2867775
Genome map
AA seq 337 aa AA seqDB search
MPAFPFTAIVAQEEMKRALLIAAVDPSVGGVLVFGDRGTGKSTAVRALAALLPKIRAVAG
CPYSCSPDSPTEACPHCARGRGKSHQIPVPVVDLPLGATEDRVVGALDLERALTKGEKAF
EPGLLARANRGFLYIDEANLLEDHLVDLLLDVAASGVNTVEREGLSLRHPARFVLVGSGN
PEEGELRPQLLDRFGLACEVTTPTDIATRIEVVRRRDAYERDGEAFCAAQGKAEKALQKT
ILAARERLGSVSVPDAVLENAARLCLALGTDGLRGELTLMRTARALAALEGADIVSVAHL
RQVAPSALRHRLRRNPLDESGSTARVARAVEEVLGAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcctttcccttcaccgccatcgtcgcccaggaggagatgaagcgggcgctgctg
atcgcggcggtcgatccgtccgtcggcggcgtcctcgtcttcggggaccggggcaccggc
aagtccacggcggtgcgggcgctcgcggcgctgctgccaaagatccgggcggtcgccggc
tgtccctattcctgctcgcccgacagtccgaccgaggcctgcccgcactgcgcgcggggg
cggggaaagagccaccagatcccggtgccggtggtcgatctgccgctcggcgccaccgag
gaccgggtggtcggcgcgctcgatctggagcgggcgctgacgaagggggaaaaggcgttc
gagccgggcctgctggcgcgagccaaccgcggcttcctctacatcgacgaggcgaacctg
ctcgaggaccatctcgtggacctcctgctcgacgtggcggcgtccggggtcaacaccgtc
gagcgcgagggcctgtcgctgcgccatcccgcccgcttcgtcctcgtcggcagcggcaac
ccggaggagggggagctgcgtccgcagcttctcgaccgcttcggcctcgcctgcgaggtg
acgacgccgaccgacatcgccacccgcatcgaggtggtgcggcggcgcgacgcctacgag
cgggacggcgaagcgttctgcgccgcgcaaggaaaggcggaaaaagcgctccagaagacg
atcctcgcggcccgcgagcgtctcggcagcgtgagcgtgcccgatgcggttctggagaac
gcagcccggctctgcctcgcgctcggcaccgatggcctgcgcggcgaactcacgctgatg
cgtacggcccgggcgctcgccgccctcgaaggtgcggacatcgtctcggttgcgcatctc
cgacaggtggcgccgagcgcgcttcgtcaccgcctacgccgcaacccgctcgacgagtcg
ggctccacggcgcgcgtggcgcgggccgtggaggaggtgctgggagccgggtga

DBGET integrated database retrieval system