KEGG   Methylobacterium extorquens CM4: Mchl_2941Help
Entry
Mchl_2941         CDS       T00809                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mch00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3103140..3105494
Genome map
AA seq 784 aa AA seqDB search
MTALDEKAAARNEGQAAANVPNRSGSTEAPRAPRSSDALGGEGAPRVGRSASQARDGHLH
PDAIAAVMAADHGDAFGVLGPHQVAPGTWEVRAILPEAKAARLVTGGQSIAFERVHPDGF
YVASVKSEGRPLYEIEVEAWDGTSTRRHDPYGFGPSLEQSEIDGLRLIGSNLVYRVLGAH
AGELDGIAGFRFAVWAPNARRVSVVGDFNDWDGRRHPMRLWLNGGVWELFVPGLKAGQNY
KFEIRGPDGSVLPLKADPVAFRAQHPPQTASVLQSLNEPQWNDAAWMDTRGEKDPRHAAM
SVYEVHLGSWARVPDEGNRYLTYKELSDRLIPYVKDLGFTHIELLPITEYPFDGSWGYQP
VSLFAPTSRFGTPDDFVDFVNAAHAAGIGVMLDWVPGHFPLDAHGLGLFDGTHLYEHADP
RQGFHQDWGTYIYNFGRVEVSAFLTANARFWLEHYHLDGLRVDAVASMLYLDYSRRAGEW
IPNQYGGNENLDAINFLRKTNEATYSHAPGTITVAEESTSWPGVSHPTYTGGLGFGFKWN
MGWMHDTLKYMSEDPIHRRYHHHNLTFGLLYAFSENFVLPLSHDEVVHGKGSLLGKMPGD
RWQKFANLRAYFGFMWGHPGKKLLFMGGEFGQEREWNHNQSLDWHLLDDPLHGGVKDLIR
DLNHVYTSTPALYSRDVEASGFQWLVADDSDNSVIAWARKGKAEGEVAIVVSNFTPVPRE
GYRVGVPTAGFYREAINSDAERYGGSNVGNMGGVQSQAEQSHGQPHSLSLTLPPLSTLIL
IREG
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgacggctctggacgagaaggccgcggctcgtaacgaggggcaggcggccgccaacgtc
ccgaacaggtcaggctcgaccgaggcgccgcgcgcgccccggtcgtcggatgcgcttggc
ggcgagggggctccccgtgtgggccgctccgcctcgcaagcgcgcgatggccacctccat
cccgatgccattgcggccgtgatggcggccgatcacggcgacgcgttcggcgtcctcggg
ccgcatcaggttgcgcccggtacgtgggaggtccgtgcgatcctgccggaggcgaaggcg
gcccgcctcgtcacgggcgggcagagcatcgcgttcgagcgcgttcatcccgacgggttc
tacgttgcgagcgtgaagagcgagggtcggcccctctacgagatcgaggtcgaggcgtgg
gacggcaccagcacccgccgtcacgatccctatggcttcggcccgtcgctcgaacagagc
gagatcgacggcctacggctgatcggcagcaacctcgtctatcgcgtgctcggcgcgcat
gcgggtgagctcgacggcatcgccgggttccgcttcgcggtctgggcaccgaatgcccgc
cgcgtcagcgtcgtcggcgacttcaacgattgggacggccggcgccacccgatgcggctg
tggctcaatggcggcgtctgggagctgttcgtgccgggtctcaaggccgggcagaactac
aagttcgagatccgtggccccgacgggtccgtgctgccgttgaaggccgatccggtcgcc
ttccgcgcccagcatccgccgcagacggcctcggtgctccagagtctcaacgagccgcaa
tggaacgatgcggcctggatggatacgcgcggtgagaaggatccgcgccacgccgccatg
tcggtctacgaggtccatctcggctcgtgggcgcgggtgccggacgagggcaaccgctac
ctgacctacaaggagctgtccgaccggctgatcccgtacgtgaaggacctcggcttcacg
catatcgagcttctgccgatcaccgagtacccgttcgacggctcctggggctaccagccg
gtctcgctgttcgcgccgaccagccgcttcggcacgcccgacgacttcgtcgatttcgtc
aacgcggcgcatgcggccggcattggcgtgatgctcgattgggtgccggggcacttcccc
ctcgacgcccacggcctcggcctgttcgacggcacgcatctctacgagcatgccgatccg
cgccagggcttccaccaggattggggcacctacatctacaattttggtcgggtcgaggtg
tccgccttcctcacggccaatgcccgcttctggctcgagcactaccatctcgacggcctg
cgcgtggatgcagtcgcgtcgatgctctacctcgactactcgcgccgcgcgggcgagtgg
attccgaaccagtacggcggcaacgagaatctcgacgccatcaacttcctgcgcaagacc
aacgaggccacctacagccacgcgccgggcaccatcacggtggccgaggaatcgacctcg
tggccgggcgtgtcgcacccgacctacacgggcggtctcggcttcggcttcaagtggaac
atggggtggatgcacgacaccctgaaatacatgtcggaggatccgatccaccggcgttac
caccaccacaacctaaccttcggcctgctctacgccttctcggaaaacttcgtgctgccg
ctctcccatgacgaggtggtgcacgggaagggctcgctgctcggcaagatgccgggcgac
cgctggcagaagttcgccaatctacgcgcctatttcggcttcatgtggggtcatcccggc
aagaagctgctctttatgggcggcgagttcggccaggagcgcgagtggaaccacaaccag
tcgctcgactggcacctgctcgacgatcccctgcatggcggcgtgaaggatctgatccgc
gacctcaaccacgtctacacctcgaccccggcgctctattcgcgcgacgttgaggccagt
ggcttccagtggctggtggcggacgattccgacaactcggtcatcgcctgggcgcgcaag
ggcaaggcagagggcgaagtcgccatcgtcgtctcgaactttacgccggtgccgcgtgag
ggctaccgcgtcggcgtaccgacggccggtttctaccgcgaggcgatcaactcggacgcc
gagcgctatggcggctcgaatgtcggcaatatgggcggcgtgcagagccaagccgagcag
agccacggccagccgcattcgctgagcctgaccctgccgccgctctcgaccctgatcctg
attcgcgagggctga

DBGET integrated database retrieval system