KEGG   Methylobacterium extorquens CM4: Mchl_3017Help
Entry
Mchl_3017         CDS       T00809                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00010  Glycolysis / Gluconeogenesis
mch00020  Citrate cycle (TCA cycle)
mch00620  Pyruvate metabolism
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
mch01130  Biosynthesis of antibiotics
mch01200  Carbon metabolism
Module
mch_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_3017
   00020 Citrate cycle (TCA cycle)
    Mchl_3017
   00620 Pyruvate metabolism
    Mchl_3017
Enzymes [BR:mch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mchl_3017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACK83855
UniProt: B7KRB9
Position
3187183..3188595
Genome map
AA seq 470 aa AA seqDB search
MPINVLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKIL
VAEGTADVPVNELIALIAEEGEDPGSVQAPKGGAEAKTAPVEPKGTPDQNAAPDGSHASY
ARVDQVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQ
AAIEGGTAKAGAAAKPEAKSEARSAPAPEKTAPKAASGGGAPAGLSLDQVKGFYEKGSFE
EVPLDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKDGKPLFKLS
VNDFVIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIRKADQKTLS
TISNEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEK
RVVVKDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtcctgatgcccgcgctctccccgaccatggagaagggcaacctcgcc
aagtggctcaagaaggagggcgacgccatcaagtccggcgacgtcatcgccgagatcgag
accgacaaggccaccatggaggtcgaggcggtcgatgagggcgtgctcgccaagattctc
gtggccgaaggcactgccgacgttccggtcaacgagctgatcgcgctgatcgccgaagag
ggcgaggatccgggcagcgtccaggcgcccaagggtggtgccgaggcgaagactgccccc
gtcgagccgaagggcacgcccgaccagaacgccgcgcccgatggctctcacgcctcctac
gcgcgcgtcgatcaggtgcccgagggtgccaagccgaacggcgcggcgcagccggcaggc
tccggcgaccgcgtcttcgcttcgccgctcgcgcgccgcatcgcgaagcaggagggtgtc
gatctctccgctgtgaagggctcgggtccgcatggccgcgtcatccagcgcgacgtgcag
gcggcgatcgaaggcggtacggcgaaggcgggtgcggcggccaagcccgaggccaagtcg
gaggccaggagtgctcctgcgcccgagaaaaccgcgccgaaagcggcttccggcggcggc
gcaccggccgggctcagcctcgatcaggtcaagggcttctacgagaagggtagcttcgag
gaagtgccgctcgacggcatgcgcaagaccatcgccaagcgcctcaccgaggcgatgcag
gtcgcgccgcacttctacctcaccgtcgattgcgaactcgatgcgctgatgaagctgcgc
gagacgctcaacggctcggccggcaaggacaaggacggcaagccgctgttcaagctctcg
gtgaacgacttcgtcatcaaggcgatgggcctcgcgctcacccgcgtccccgccgccaac
gccgtctgggcggaggaccgcatcctgcgcttcaagcacgccgaggtcggcgtcgcggtg
gcgatcgatggtggcctgttcaccccagtgatccgcaaggccgaccagaagacgctctcc
accatctccaacgagatgaaggatttcgcaggccgcgcgcgcgccaagaagctgaagccg
gaagagtaccaaggcggcgtcacctcggtgtcgaacctcggcatgttcggcatcaagcac
ttcacggcggtgatcaacccgccgcaatcgagcatcctcgcggtcggcgcgggcgagaag
cgcgtcgtggtgaaggacgggcagccgaccgttgcccaggtgatgacggcgaccctctcc
tgcgatcaccgcgtcctcgacggcgcgctcggcgccgagctgatcgcggccttcaaggga
ctgatcgagaacccgatggggatgctcgtctaa

DBGET integrated database retrieval system