KEGG   Methylobacterium extorquens CM4: Mchl_3066Help
Entry
Mchl_3066         CDS       T00809                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mchl_3066
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mchl_3066
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mchl_3066
Two-component system [BR:mch02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mchl_3066
Bacterial motility proteins [BR:mch02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mchl_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3245450..3246535
Genome map
AA seq 361 aa AA seqDB search
MNRGAANPRVRVLVVEDSLVVRILLTHIIARDPRLELAGAVESGEAALAAIETVRPDVIS
MDIRLPGIDGLETTRRIMASRPTPIVVIADSVEDSSLKISMNALRAGALSVVEKPVATTN
DGYEAVAGQICTQLRIMAAVPVIRRRPIGAEWNARKTAPMPELGVPSESEAAPNVLAVAA
STGGPPALAKVIGGLSADFPLPILLVQHMGAAFMDGFASWLDGVVPLAVGVARDGQTMQA
GHVYVAPGDRHLELGTNGTLRVSDGAPVGGQRPAATVLFRSVARQAGAQGIGVLLTGMGE
DGAQGLLDMRKAGAATVAEHESSAVVYGMPAAAVRLNAASRVLPVDQVAPHLVRLAQRKP
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagaggggctgcgaatccgcgcgtgcgcgtgctggttgtcgaggattcgctcgta
gtgcgaattctcctcacccacatcatcgcccgcgatccgcggctagaattggccggcgcg
gtggaatccggcgaggcggcgctcgcggcgatcgagaccgtgcgcccggacgtcatctct
atggatatccgcctgccgggcatcgacgggctggagacgacccgccgcatcatggcgagc
cggccgacgccgatcgtggtgatcgccgattcggtcgaggattcctcgctcaagatttcg
atgaacgccttgagggccggcgcgctctcggtggtcgagaagccggtggccacgaccaac
gacggctacgaagcggtcgccggccagatctgcacgcagctgcgcatcatggccgcggtc
ccggtcatccgccgccgcccgatcggggcggagtggaacgcgcgcaagaccgctcccatg
cccgaactgggcgtcccctcagaatcggaggccgcgccgaacgtactggccgtggctgcc
tcgaccggcggcccgccggcgctcgccaaagtgatcggcggcctgtcggcggatttcccg
ctcccgatcctgctggttcagcacatgggcgccgccttcatggacggctttgcaagttgg
ctcgacggcgtcgtgccgctcgccgtcggggtggcgcgggacggtcaaacgatgcaggcc
ggccatgtctacgtcgcccccggcgaccgtcatctcgaactcggaacgaacggcacgctg
cgggtgagtgacggcgcccccgtcggcggccagcgcccggccgcgaccgtgctgttccgc
tccgtcgcccggcaggccggcgcgcaaggcatcggcgtgctgctcaccggcatgggcgag
gacggggcgcagggccttctcgacatgcgcaaggccggggccgccacggtggccgaacac
gagagcagcgccgtcgtctacggcatgcccgcggcggcggtgcgcctcaacgcggcgtcc
cgcgtgctccccgtcgatcaagtggcgccccatctcgtgcggctcgcgcagaggaagcca
gcatga

DBGET integrated database retrieval system