KEGG   Methylobacterium extorquens CM4: Mchl_3286Help
Entry
Mchl_3286         CDS       T00809                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mch  Methylobacterium extorquens CM4
Brite
Enzymes [BR:mch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mchl_3286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3464042..3465100)
Genome map
AA seq 352 aa AA seqDB search
MQGQMQQADPDLDRALAPAHRAWEALRQYALPPSPRNYELLHTFFAGANPPLSERLAACL
APGGTLTEEQASALYDACIAGTATEASVLDGAGRLAEAAGTLAERVAGSRKALAGYGDAL
THWSGRLNARPTADELMTALVALIGETEQAQTRNHLLEEQLSVSAAHIAKLHKDLVETQR
AAATDALTGLANRKTFDGFLRDSIARTRSDSGSTFSLLMLDIDHFKGLNDRHGHRFGDQV
LRLVGRLLSAKTTDRDLAARYGGEEFAIVLGEAGIGAGVALAQEICGRLRGQRLVKRGTG
DVVAQVTISAGVAQYRPGEAARDVIERADRALYEAKRTGRDRVCPTPRAAVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagggacagatgcagcaggcggatccggacctcgaccgcgctctggctcccgcgcac
cgcgcctgggaggcgctgcggcagtatgcgctgccgccctccccgcggaactacgaattg
ctgcacaccttcttcgccggcgccaatccgccgctgagcgaacgcctcgcggcctgtctg
gcacccggtggaacgctgaccgaggagcaggcgagcgcgctctacgacgcctgcatcgcc
gggaccgcgacagaggcctccgtgctcgatggggcgggccggctggcggaggcggccggt
accctggccgagcgcgtcgcgggcagtcggaaggcgctcgccggctatggtgatgccctg
acccattggtccggccgcctgaatgcacggccgaccgccgatgagctgatgacggcgctc
gtcgccctgatcggtgagaccgagcaggcgcagacccgcaatcacctgctcgaggagcag
ctctcggtctccgccgcccacatcgccaagctgcacaaggatctcgtcgagacgcagcgc
gcggcggcgaccgatgccctgacggggcttgccaaccgcaagaccttcgacgggttcctg
cgcgactcgatcgcccgcacccggagcgattccggcagcactttctccctgctcatgctc
gacatcgaccacttcaagggtctcaacgaccggcacggccaccgcttcggcgatcaggtg
ctgcgcctcgtcggacggctgctcagcgcgaagacgacggatcgcgacctcgccgcgcgc
tacggcggcgaggaattcgcgatcgtgctcggcgaggccggcatcggcgccggcgtcgcg
ctcgcccaggagatctgcggccggctgcggggtcagcggctggtcaagcgcggcaccggc
gatgtcgtggcacaggtcacgatctcggctggcgtcgcgcaatacaggccgggcgaagcc
gcccgcgatgtgatcgagcgggccgaccgcgcgctctacgaggccaagcggaccggccgc
gaccgtgtctgcccgacgccgcgagctgcagtcgcgtga

DBGET integrated database retrieval system