KEGG   Methylobacterium extorquens CM4: Mchl_3286Help
Entry
Mchl_3286         CDS       T00809                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mch  Methylobacterium extorquens CM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3464042..3465100)
Genome map
AA seq 352 aa AA seqDB search
MQGQMQQADPDLDRALAPAHRAWEALRQYALPPSPRNYELLHTFFAGANPPLSERLAACL
APGGTLTEEQASALYDACIAGTATEASVLDGAGRLAEAAGTLAERVAGSRKALAGYGDAL
THWSGRLNARPTADELMTALVALIGETEQAQTRNHLLEEQLSVSAAHIAKLHKDLVETQR
AAATDALTGLANRKTFDGFLRDSIARTRSDSGSTFSLLMLDIDHFKGLNDRHGHRFGDQV
LRLVGRLLSAKTTDRDLAARYGGEEFAIVLGEAGIGAGVALAQEICGRLRGQRLVKRGTG
DVVAQVTISAGVAQYRPGEAARDVIERADRALYEAKRTGRDRVCPTPRAAVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagggacagatgcagcaggcggatccggacctcgaccgcgctctggctcccgcgcac
cgcgcctgggaggcgctgcggcagtatgcgctgccgccctccccgcggaactacgaattg
ctgcacaccttcttcgccggcgccaatccgccgctgagcgaacgcctcgcggcctgtctg
gcacccggtggaacgctgaccgaggagcaggcgagcgcgctctacgacgcctgcatcgcc
gggaccgcgacagaggcctccgtgctcgatggggcgggccggctggcggaggcggccggt
accctggccgagcgcgtcgcgggcagtcggaaggcgctcgccggctatggtgatgccctg
acccattggtccggccgcctgaatgcacggccgaccgccgatgagctgatgacggcgctc
gtcgccctgatcggtgagaccgagcaggcgcagacccgcaatcacctgctcgaggagcag
ctctcggtctccgccgcccacatcgccaagctgcacaaggatctcgtcgagacgcagcgc
gcggcggcgaccgatgccctgacggggcttgccaaccgcaagaccttcgacgggttcctg
cgcgactcgatcgcccgcacccggagcgattccggcagcactttctccctgctcatgctc
gacatcgaccacttcaagggtctcaacgaccggcacggccaccgcttcggcgatcaggtg
ctgcgcctcgtcggacggctgctcagcgcgaagacgacggatcgcgacctcgccgcgcgc
tacggcggcgaggaattcgcgatcgtgctcggcgaggccggcatcggcgccggcgtcgcg
ctcgcccaggagatctgcggccggctgcggggtcagcggctggtcaagcgcggcaccggc
gatgtcgtggcacaggtcacgatctcggctggcgtcgcgcaatacaggccgggcgaagcc
gcccgcgatgtgatcgagcgggccgaccgcgcgctctacgaggccaagcggaccggccgc
gaccgtgtctgcccgacgccgcgagctgcagtcgcgtga

DBGET integrated database retrieval system