KEGG   Methylobacterium extorquens CM4: Mchl_3565Help
Entry
Mchl_3565         CDS       T00809                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00071  Fatty acid degradation
mch00280  Valine, leucine and isoleucine degradation
mch00281  Geraniol degradation
mch00310  Lysine degradation
mch00362  Benzoate degradation
mch00380  Tryptophan metabolism
mch00410  beta-Alanine metabolism
mch00640  Propanoate metabolism
mch00650  Butanoate metabolism
mch00903  Limonene and pinene degradation
mch00930  Caprolactam degradation
mch01040  Biosynthesis of unsaturated fatty acids
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
mch01130  Biosynthesis of antibiotics
mch01200  Carbon metabolism
mch01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mchl_3565
   00650 Butanoate metabolism
    Mchl_3565
  Lipid metabolism
   00071 Fatty acid degradation
    Mchl_3565
   01040 Biosynthesis of unsaturated fatty acids
    Mchl_3565
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mchl_3565
   00310 Lysine degradation
    Mchl_3565
   00380 Tryptophan metabolism
    Mchl_3565
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mchl_3565
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mchl_3565
   00281 Geraniol degradation
    Mchl_3565
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mchl_3565
   00930 Caprolactam degradation
    Mchl_3565
Enzymes [BR:mch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mchl_3565
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mchl_3565
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mchl_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored NAD_Gly3P_dh_N Sacchrp_dh_NADP FAD_binding_3 2-Hacid_dh_C ApbA NAD_binding_8 Pyr_redox_2 GIDA AlaDh_PNT_C TrkA_N Shikimate_DH Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACK84385
UniProt: B7KVH7
Position
complement(3750961..3753162)
Genome map
AA seq 733 aa AA seqDB search
MTATENFRFETDADGIALATWDMPGRSMNVITMEVMAELERIVDTVVADEAIKGCVIVSG
KNNFSGGADLTMLQGLGVEYERLKASEGEEVAMRHFFEESRRLSLVFRKLETCGKPFAAA
VHGLCLGGAFELALACHHRVLADDDKTRVGLPEIKVGLFPGGGGTQRVSRLMQTGDALQM
LFKGEQIRALMAKNMGLAHAVAPAAEIVERAKAWIREGGSAVAPWDVPKFKAPSGKVYSP
AGMMIWPPANAIYRRETHDNYPAAKAILASVYEGLQLPMDLGLRVESRYFAHILRTKEAQ
AMIRTLFISMGEINKGARRPKDVEATKVGKVGVIGAGFMGAGIAYVTAQAGMQVVLIDRD
QEAADAGKAHCHKLITGQINRGKAKTADRDALLARITATPDYGALSDCDLVIEAVFEDPK
VKAEVIAKVEAALPAHAIFASNTSTLPISGLAQTSKRPEQFVGIHFFSPVEKMLLVEIIR
GNQTGDRAVATALDYVRAIKKTGIVVNDSRGFFANRCVLAYIHEGHKMLTEGVPPAMIEN
VARMAGMPVGPLSLNDEVALDLGLKIMRATEAQLGEGAVDPDQKRLLVAMVETHGRLGRK
NKRGFYDYPEGGQKTLWPGLAEIQPNRLDPESIDIDELKHRFLVVQALEAARTMQEGVVT
DPREADVGSILGFGFAPFTGGALSYIDFMGAKAFVALARELEARHGARFTPPDNLLAMAE
SGARFYDALKQAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccgagaatttccgcttcgagaccgatgccgacggcatcgcgctcgcgacc
tgggacatgccgggccgttcgatgaacgtcatcaccatggaggtgatggcggaactggag
cggatcgtcgacacggtcgtcgccgacgaggccatcaagggctgcgtcatcgtctcgggg
aagaacaacttctccggcggcgccgacctcaccatgcttcagggcctcggggtcgagtac
gagcggctgaaggcgagtgagggcgaggaggtggccatgcgccacttcttcgaggagtcg
cggcgcctcagcctcgtgttccgcaagctcgagacgtgcggcaagccgttcgcggcggcg
gtgcacggcctgtgccttggcggcgccttcgagctggcgctggcctgccaccaccgggtg
ctcgccgacgacgacaagacccgcgtcggcctgcccgagatcaaggtcggcctgttcccc
ggcggcggcggcacgcagcgcgtgtcccgtctgatgcagaccggcgacgcgctgcagatg
ctgttcaagggcgagcagatccgcgcgctcatggccaagaacatggggctggcccacgcc
gtcgccccggccgcggagatcgtcgagcgggccaaggcctggatccgcgagggcggctcg
gcggtggcaccctgggacgtgccgaagttcaaggcgccgtccggaaaggtctactcgccc
gccggcatgatgatctggccgccggccaacgcgatctatcgccgcgagacccacgacaat
tatccggccgccaaggcgatcctggcctcggtctacgagggcctgcagctgccgatggat
ctcggcctccgggtcgagagccgctacttcgcccatatcctgcgcaccaaggaagcgcag
gcgatgatccgcaccctgttcatctccatgggtgagatcaacaagggcgcccgccgcccg
aaggatgtggaggcgaccaaggtcggcaaggtcggcgtgatcggcgccggcttcatgggc
gcgggtatcgcctacgtcacggcgcaggccgggatgcaggtcgtgctgatcgaccgcgat
caggaggcggccgatgccggcaaggcgcattgccacaagctcatcaccggccagatcaac
cgcggcaaggccaagaccgctgaccgcgacgcgctgctcgcccgcatcaccgccaccccc
gattacggtgccctgtccgattgcgacctcgtgatcgaggcggtgttcgaagaccctaag
gtcaaggccgaggtgatcgccaaggtcgaggcggcgctgccggcgcacgcgatcttcgcc
tccaacacctcgaccctgccgatctccggcctcgcccagacctcgaagcggcccgagcag
ttcgtcggcatccacttcttctcgccggtggagaagatgctgctcgtggagatcatccgc
ggcaaccagaccggagaccgcgcggtcgccaccgccctcgactacgtgcgcgcgatcaag
aagaccggcatcgtcgtcaacgattcccgcggcttcttcgccaaccgctgcgtgctcgcc
tacatccatgagggccacaagatgctcaccgagggcgtgcccccggcgatgatcgagaac
gtggcgcggatggccggcatgccggtcggcccgctctcgctcaacgacgaggtggcgctc
gatctcggcctcaagatcatgcgggcgaccgaggcgcagctcggcgagggcgctgtcgat
ccggaccagaagcggctcctcgtcgcgatggtcgagacgcatggccggctcgggcgtaag
aacaagcgcggcttctacgactaccccgagggcggccagaagacgctctggccggggctc
gccgagatccagccgaaccggctcgacccggagagcatcgacatcgacgagctgaagcac
cgcttcctcgtggtgcaggcgctggaggccgcccgcacgatgcaggagggcgtggtgacc
gatccgcgcgaggcggatgtcggctcgatcctcggcttcggcttcgcccccttcaccggc
ggcgcgctctcctacatcgacttcatgggcgccaaggccttcgtggcgctggcacgtgag
ctcgaagcccggcacggcgcccgcttcaccccgccggacaacctcctggcgatggccgag
tccggggcgcgcttctacgacgcgctgaagcaggcggcgtag

DBGET integrated database retrieval system