KEGG   Methylobacterium extorquens CM4: Mchl_3578Help
Entry
Mchl_3578         CDS       T00809                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mchl_3578
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mchl_3578
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mchl_3578
Enzymes [BR:mch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mchl_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3768055..3769467)
Genome map
AA seq 470 aa AA seqDB search
MLHVSTRGAAAPLSFSDALLAGLARDGGLYVPESWPQISRAEIAGFAGMRYAEVAKRVLR
PLIDGEIPDDALDEMIEAAYATFRHPAICPLTQIDDNLFLMELFHGPTLAFKDVAMQLLG
RLMDYVLRQKGGRATIVGATSGDTGSAAVEAFKGLDQVDVFILFPHGRVSEVQRRQMTTV
NAPNVHALAIDGNFDDCQNIVKAMFQHGDFADRVKLSGVNSINWARVAAQTVYYFTSAVA
LGAPHRKVSFAVPTGNFGDILAGWVAKRMGLPIERLMIGTNANDILARTLEHGAYEPRGV
QPTTSPSMDIQISSNFERLLFEALGRDASALGRLMAGLKQSGGFSLSPEVLGTVRDEFDA
TAVREPDVVEEIAGTFRKTGLVLDPHSAIGVRAGRRLLEKDPATPVVALATAHPAKFPNA
VSQATGGGRPVLPPHLAELMTRPETVANLANDQAAIERYITEHARITRGN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcacgtctcgacccgcggcgccgctgcgcccttgagcttttccgatgcgctgctc
gccggccttgcccgcgacggcggtctctacgtgcccgagagctggccgcagattagccgt
gcggagatcgcgggctttgccggcatgcgctacgccgaggttgccaagcgcgtgctgcgt
ccgctcatcgacggcgagattccggacgacgcgctcgacgagatgatcgaggcggcctac
gccaccttccgccatccggcgatctgcccgctcacccagatcgacgacaacctgttcctg
atggagctgtttcacgggccgacgctcgcgttcaaggacgtggcgatgcagctcctcggg
cggctgatggattacgtgctgcgccagaagggcggccgcgccaccatcgtcggcgccacc
tcgggcgatacgggcagtgccgcggtcgaggccttcaaggggctcgatcaggtcgacgtg
ttcatcctgtttccgcacggccgcgtctcggaggtgcagcgccggcagatgaccacggtc
aacgcgccgaacgtccacgcgctcgccatcgacggcaatttcgacgattgccagaacatc
gtgaaggcgatgttccagcacggcgacttcgccgacagggtgaagctctcgggcgtcaac
tcgatcaattgggcccgcgtcgccgcgcagaccgtctactacttcacgagtgcggtggct
ctgggcgccccgcaccggaaggtgtcgttcgcggtgccgaccggcaatttcggcgacatc
ctcgccggctgggtcgccaagcggatgggcctgccgatcgagcggctgatgatcggcacc
aatgccaacgacatcctggcccgcaccctggagcacggggcctacgagccccgcggcgtg
cagccgacgacctcgccctcgatggacatccagatctcctcgaacttcgagcggctgctg
ttcgaggcgttgggccgcgatgcctccgcgctcggccgcctgatggcgggtctgaagcag
tcgggcgggttctcgctgagccccgaggtgctgggcaccgtgcgcgacgagttcgatgcg
accgccgtgcgcgagcccgacgtcgtggaagagatcgcgggcaccttccgcaagaccggc
ctcgtgctcgatccgcacagcgccatcggcgtgcgtgccggtcgcaggctgctggagaag
gatccggccaccccggtcgtggcgctggccaccgcgcaccccgccaaattcccgaatgcg
gtctcgcaggcgaccggcggcgggcgcccggttctgccgccccacctcgccgaactgatg
acacggcccgagacggtggcgaacctcgccaacgatcaggccgcgatcgagcgctacatc
acggaacacgcccgcatcacccggggcaactga

DBGET integrated database retrieval system