KEGG   Methylobacterium extorquens CM4: Mchl_3598Help
Entry
Mchl_3598         CDS       T00809                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mchl_3598
   00052 Galactose metabolism
    Mchl_3598
   00500 Starch and sucrose metabolism
    Mchl_3598
   00520 Amino sugar and nucleotide sugar metabolism
    Mchl_3598
Enzymes [BR:mch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mchl_3598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3793211..3794092
Genome map
AA seq 293 aa AA seqDB search
MGSRQMKQIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIF
VTGRGKAVIEDHFDIAFELDHMLQERGKQAAYEELKKDLPKAGQTSFTRQQAPLGLGHAV
WCAREIVGDEPFAVLLPDMLSRGCMGQMLKAYEQHGGNVIAVEEVKPEETHQYGIVAVGE
TFGQTFEITGMVEKPKQGTAPSNYIISGRYILQPEIFSILERGETGAGGEIQLTDAMIRL
AEEQKFYGMRFDGRTYDTGSKIGFLTANLAYGLERPELADALKAEIRALLGEA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccgccagatgaaacaaattcgcaaggccgtccttcccgtcgcgggtctcggc
acgcgcttcctgccggccaccaaggccgttccgaaggagatgctcaccgtcgtcgaccgc
ccggtcgtccagcacgtcgtcgatgaagcccgcgaggccggcatcgagcacttcatcttc
gtgaccggccgcggcaaggcggtgatcgaggatcatttcgatatcgcgttcgaattggac
cacatgctgcaggagcgcggcaagcaggcagcctacgaggagttgaagaaggacctgccc
aaggccggccagaccagcttcacccggcagcaggcgccgctgggcctcggccacgccgtc
tggtgcgcccgagagatcgtcggcgacgaacccttcgccgtgctgctgcccgacatgctg
agccgcggctgcatgggccagatgctgaaggcctacgagcagcatggcggcaacgtcatc
gccgtggaagaggtgaagcccgaggagacccaccagtacggcatcgtcgccgtcggcgag
accttcggccagaccttcgagatcaccggcatggtcgagaagcccaagcagggcaccgcg
ccctcgaactacatcatctccggccgctacatcctacagcccgagatcttctcgattctg
gagcggggcgagaccggcgcgggcggcgagatccagctcaccgacgcgatgatccggctg
gccgaagagcagaagttctacggcatgcgcttcgatgggcgcacctacgacaccgggtcc
aagatcggcttcctcaccgccaacctcgcctacggcctggagcggccggaactggccgat
gccttgaaagcggagatccgcgcgcttctcggcgaggcttga

DBGET integrated database retrieval system