KEGG   Methylobacterium extorquens CM4: Mchl_3707Help
Entry
Mchl_3707         CDS       T00809                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mch  Methylobacterium extorquens CM4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mch00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mch00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3910744..3911775
Genome map
AA seq 343 aa AA seqDB search
MTSASMTSASTPRAVILGCSGTALTPEEAAFFRDLRPWGFILFKRNIGTPDEVRALTAAL
RETVGRADAPILIDQEGGRVQRMGPPHWPKYPACGRFGALGDDAAVMARLGARLMAHDLA
SVGINVDCAPMLDVPVAGSDNIIGDRAYGDTPERVIELGRAVAEGLMAGGVLPVIKHIPG
HGRATCDSHLDLPVVEADRVSLGESDFRPFRALADLPLAMSAHVVFTALDPERPATLSER
VIREIVRGEIGFDGLLMTDDLSMHALQGPFRERAQAAYRAGIDVVLHCNGRMDEMRAVAE
AASDLAGECARRAEAALARLTPPDAIDVDEARARFDAAFGAVA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagccagcatgacctccgccagcacgccccgcgccgtcatcctcggctgttcc
ggcacggcgctgacgcccgaggaggccgccttcttccgcgatctgcggccctggggcttc
attctgttcaagcgcaacatcggcacgccggacgaggtacgcgccctgaccgccgccctg
cgcgaaacggtcgggcgggcggatgcgccgatcctgatcgatcaggagggcgggcgggtg
cagcgcatgggccccccgcactggccgaaatatcccgcgtgcggccgtttcggtgccctc
ggtgacgacgccgcggtgatggcccggctcggcgcccggctgatggcgcacgacctcgcc
tcggtgggcatcaacgtcgattgcgcgccgatgctcgacgttccggtcgcaggctcggac
aacatcatcggcgaccgggcctacggcgacacgccggagcgggtgatcgaactcggccgc
gccgtcgccgaggggttgatggcgggtggcgtgctgccggtgatcaagcacatccccggt
cacggccgggcgacctgcgacagccatctcgacctgcccgtggtcgaggccgaccgcgtg
agtctgggcgagagcgacttccgcccgttccgggcgctggccgacctgccgctcgccatg
agcgcgcatgtggtgttcaccgccctcgaccccgagcggccggcgaccctgtcggagcgc
gtgatccgcgagatcgtgcggggcgaaatcggcttcgacgggctcctgatgaccgacgac
ctgtcgatgcacgcgctccagggcccgttccgcgagcgggcgcaagccgcctaccgggcc
ggcatcgatgtggttctccattgcaacggacgcatggacgagatgcgcgccgtcgccgaa
gccgcgtccgatctggcgggggagtgcgcgcgccgggccgaggccgcgcttgcccgcctc
acgcctccggatgccatcgacgtggacgaggcgcgcgcgcgcttcgacgcggccttcggc
gcggtcgcataa

DBGET integrated database retrieval system