KEGG   Methylobacterium extorquens CM4: Mchl_4207Help
Entry
Mchl_4207         CDS       T00809                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mchl_4207
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mchl_4207
   00640 Propanoate metabolism
    Mchl_4207
   00660 C5-Branched dibasic acid metabolism
    Mchl_4207
Enzymes [BR:mch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mchl_4207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4431550..4432704)
Genome map
AA seq 384 aa AA seqDB search
MNFLEHVAKARVLAPAGIPVPRAVLCRTPEEAAAAFGELGPCMVKAQVPTGKRGKAGGIK
PANAAEEARGVAERILGMTIDCHAVGAVLLEQQATIASEFYAAVLIDTASRCPLVLFSTE
GGMDIEEVAATRPDALRRHAVDPEAGFDAAAARALLAGLDLGGAEGAVADILASLTETSG
RVDAELIEINPLAVLDDGRVVALDCKLTLDDSAAFRQGDLAAEAAEEPMTELEREGAAQG
LKFIQLDGDVGVLANGAGLTMTTMDVISHCGGRPANFLEIGGEAYTKSEAALKLVLSNPG
VKSLVVNFCGAFARTDVMAEGVVTAWKRLDPDIPVFFSIHGTGEDEAVRLVREGLGCEPF
DLMEDAVQAAVDAAHSTASRGVAR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcctggagcacgtcgccaaggcgcgggtcctcgcgcccgccggcatcccggtc
ccgcgcgcggtgctgtgccggacgcccgaggaggccgccgccgccttcggagaactcggc
ccctgcatggtcaaggcccaggtgccgaccggcaagcgcggcaaggccggcggcatcaag
ccggccaacgcggcggaagaagcccgcggcgtcgccgagcgcatcctcggcatgacgatc
gactgccacgccgtcggcgcggtcctgctggagcagcaggcgacaatcgccagcgagttc
tacgccgcggtgctgatcgacaccgcgagccggtgcccgctggtcctgttctcgacggag
ggcgggatggacatcgaggaagtcgccgcgacccggccagacgctttgcgccgccacgcc
gtcgatcccgaggccggcttcgacgcggccgccgcccgcgcgctgctggcgggcctcgac
ctcgggggcgcggagggcgcggtcgccgacatcctggcctcgctcaccgagaccagcggc
cgggtcgatgcggaactgatcgagatcaacccgctcgcggtgctcgacgacggccgcgtc
gtcgccctcgactgcaagctgacgctcgacgattccgccgccttccgccagggcgacctc
gccgcggaggcggcggaggagccgatgaccgagctggagcgggagggcgccgcccaaggc
ctcaagttcatccagctcgacggcgatgtcggggtgctggccaacggcgccgggctgacg
atgacgaccatggacgtcatcagccattgcggcgggcggccggcgaacttcctcgagatc
ggcggcgaagcctacaccaagtcggaagccgcgctgaagctcgtgctgtccaatcccggc
gtcaaaagcctcgtcgtcaacttctgcggcgcgtttgcccgcaccgacgtgatggcggag
ggcgtcgtcaccgcctggaagcggctcgacccggacatcccggtgttcttctcgatccac
gggaccggggaggacgaggccgtgcgcctcgtgcgcgagggactcggctgcgagcccttc
gacctgatggaggacgcggtccaggccgccgtggacgccgcgcactcgactgcgagccgg
ggagtcgcccgatga

DBGET integrated database retrieval system