KEGG   Methylobacterium extorquens CM4: Mchl_4298Help
Entry
Mchl_4298         CDS       T00809                                 

Definition
dihydrofolate reductase
Orthology
K17364  
dihydromethanopterin reductase [EC:1.5.1.47]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mchl_4298
Enzymes [BR:mch01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase
     Mchl_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4539491..4539898)
Genome map
AA seq 135 aa AA seqDB search
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPE
FAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEAD
RWFDPAWLVGGPLRS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgttcgctgcatctgcgccatcggccagcggggccagctcggcctcaacggg
caccttccctgggagggcaacaccgatccgctcttcgtcgaggacgtgacgcgcttcttc
gcgctcaccatgggccacgtgctgatcgccggccccaagaccgtggcctccgtgcccgaa
ttcgcgttcaaggaccgcaccatcgacgtgatccgctcgcacgaggatcccgaggcggtg
ctgaagcgctatcccggccgccgcatcttcgtcggcggcggcatcgcggtctggaacgtc
tacgcgaaatacatccagcactgggacgtcacccgcctcccctacgacggcgaggccgac
cgctggttcgacccggcctggctcgtcggcgggccgctgcggagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system