KEGG   Methylobacterium extorquens CM4: Mchl_4352Help
Entry
Mchl_4352         CDS       T00809                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mch  Methylobacterium extorquens CM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4596489..4597598)
Genome map
AA seq 369 aa AA seqDB search
MWAACPVRRSLRHRMSPDPDRDRSFVLAQRSFELMRDYCACATPRAYAVWYLYVSGTQPL
MNDAVKRLTTQNGTLTSADIEGLHDTYIDGRRMAVEVDRMNSSLIAEVEGIMEMIEVSIR
STAQYGESLQALSHDIANTATSRARLREVVTTIIANTRDVTANNRTLEARMRESRSEIEA
LRETLEATRLESLTDALTGLGNRKSFEESLRKSVDLQSASAQQGKPASLIVIDIDSFKRF
NDLYGHLTGDQVLRLVAIVMREHIGQRNATLARFGGEEFGIVLPETDRVEARAIAERVRI
GVTGRELVKRSTGESLGKVTVSLGVATQREDDNAVSLLERADACLFAAKRAGRNRTLDET
EVENLRDVA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcggcgtgccccgtccgcaggagcctacgtcaccggatgagccccgatcccgat
cgtgatcgcagtttcgtgctcgcgcagcgcagcttcgagctgatgcgcgactactgtgcc
tgcgcgacgccgcgggcctacgctgtgtggtatctctacgtctccggcacgcagccgctg
atgaacgatgcggtcaaacggctcacgacgcagaacggcacgctgaccagcgccgacatc
gaggggctccacgacacctacatcgacggccgccgcatggccgtggaggtggaccggatg
aattcgagcctcatcgccgaggtcgagggcatcatggaaatgatcgaggtgtcgatccgc
tccaccgcccagtacggcgagtcgcttcaggccctgtcccacgacatcgccaacacggcc
acgagccgggcgcgtctgcgcgaggtcgtgacgacgatcatcgccaacacccgcgacgtg
accgccaacaaccgcaccctcgaagcgcggatgcgcgagagccgcagcgagatcgaggcc
ttacgcgagacgctggaggcgacccgtctggagagcctgaccgacgccctgacggggctg
ggcaaccgcaagagtttcgaggagtcgctccgcaagagcgtcgatctgcagtctgcctcg
gcgcagcagggcaagccggcgagcctgatcgtgatcgacattgattcgttcaagcgcttc
aacgacctctacggccacctgacgggggatcaggtgctgcgcctcgtcgccatcgtgatg
cgcgagcatatcggtcagagaaacgcgacgctcgcccggttcggcggcgaggaattcggc
atcgtcctgccggaaaccgaccgggtcgaggcgcgcgccatcgccgagcgggtgcgcatc
ggcgtcaccggccgcgaactggtgaagcgctccaccggcgaatcgctcggcaaggtcacg
gtctcgctcggcgtcgcgacccagcgcgaggacgacaacgcggtctccctgctggaacga
gccgacgcctgcctgttcgccgccaagcgcgccggccgcaaccgcaccctcgacgagacc
gaagtcgagaacctgcgcgacgtcgcctga

DBGET integrated database retrieval system