KEGG   Methylobacterium extorquens CM4: Mchl_4416Help
Entry
Mchl_4416         CDS       T00809                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mch03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4673226..4674125
Genome map
AA seq 299 aa AA seqDB search
MPELPEVETVRRGLAPAMVGARVARVTLRRPNLRFPFPERFAERLEGTTVLELARRAKYL
TAHLDSGESLILHLGMSGRFDVRLPDGSNLSPGDFYLEGALGTPKHDHVVMAFANGATVT
YNDARRFGFMDLVATRDLETCRHFASMGVEPLSDALDAPLLARLFARKITPLKAALLDQR
LIAGLGNIYVCEALHRSGLHPALPAGALAKPDGSPAPKAKTLVKEIKAVLTEAVAAGGST
LRDYARPDGERGAFQHGFRVYDRVGHACPTKGCTGRVGRIVQGGRSTFFCETCQVLPVR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaagtcgagaccgtgcgccgggggctcgcccccgcgatggtcggg
gcgcgcgtcgcccgcgtcaccctgcgtaggccgaacctgcgcttccccttccccgagcgc
ttcgccgagcggctggagggcaccacggtgctggagctggcgcgccgggccaaatacctc
acggcgcatctcgattccggcgagagcctgatcctgcatctcggcatgagcgggcgcttc
gatgtacggctgcccgacggctcgaacctctcgccgggcgacttctacctcgagggggcg
ctcggcacgcccaagcacgaccacgtggtgatggccttcgccaacggtgccaccgtcacc
tacaacgacgcccgccgcttcggcttcatggatctcgtggccacgcgcgatctcgagacc
tgccgccacttcgccagcatgggcgtcgagccgctctccgacgccctcgacgcgcccctg
ctcgcgcgcctgttcgcccggaagatcacgccgctgaaggcggcactgctcgaccagcgc
ctgatcgcgggcctgggcaacatctatgtctgcgaggcgctgcaccgctcgggcctccac
ccggccctgccggcgggcgcgctcgccaagcccgacggttcgccggcgcccaaggcgaag
acactcgtcaaggagatcaaggcggtgctgacggaggcagtggcggccggcggctccacc
ttgcgcgactacgcccggccggacggggagcgcggcgccttccagcacggcttccgcgtc
tacgaccgggtgggccatgcctgcccgaccaagggctgtaccggccgggtcggccggatc
gtgcagggtggacgctcgaccttcttctgcgaaacctgccaggtcctgccggtccggtaa

DBGET integrated database retrieval system