KEGG   Methylobacterium extorquens CM4: Mchl_4433Help
Entry
Mchl_4433         CDS       T00809                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mchl_4433
Enzymes [BR:mch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mchl_4433
Exosome [BR:mch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mchl_4433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4689949..4691454
Genome map
AA seq 501 aa AA seqDB search
MPDAVGAIDQGTTSTRFIVFDRRGTILAQAQREHEQIFPRPGWVEHDPREIWRNTHAVMR
EGLARAGLAPGDLAAIGITNQRETTVLWDRRTGEPLHDAIVWQDTRTDRSVAALARDGGR
DRFRAVTGLPLASYFSASKLAWLLDHVDGARAKAEDGTALFGTIDSWLVWNLTGGPDGGL
HVTDVTNASRTQLMSLATLDWDEAMLGVFRIPRAVLPTIVSSSAVLGEARDPFPGVPLGG
ILGDQQAALFGQTCFSAGEAKNTYGTGCFALMNTGPAPVASSAGLITTVAYRLDGRPPAY
ALEGSIAITGALVQWLRDNLGLIGASSEIEGLARSVEDNGGVYVVPAFSGLYAPHWRDDA
RGLIIGLTRYANRGHIARACLEATAYQTREVLEAMERDSGCPIAELRCDGGMTVNDLLMQ
FQADILDRPTLRPKVSETTALGAAYAAGLATGFWKTLEDLRDNWAVDKRWHPHIQAEERR
ALFAGWSRAVERSFGWVEENA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgcggtcggggcgatcgaccagggcaccacgagcacgcgcttcatcgtgttc
gaccgccggggcacgatcctggcgcaggcccagcgcgagcacgagcagatctttccccgt
cccggctgggtcgagcacgacccgcgggagatctggcgcaacacccatgcggtgatgcgc
gaggggctggcccgggccgggctggcgccgggggatctggccgccatcggcatcaccaac
cagcgcgagaccaccgtgctctgggaccggcggaccggcgagccgctgcacgatgccatc
gtctggcaggacacccgcaccgaccggtccgtcgccgcgctcgcccgcgacggcggtcgc
gaccgcttccgcgccgtcaccggcctgccgctcgcgagctacttctccgcctccaagctc
gcttggctgctcgaccacgtggacggggcgcgggcgaaggccgaggacggcaccgccctg
ttcgggacgatcgattcctggctcgtctggaacctcaccggcggcccggatggcgggctc
cacgtcaccgacgtgaccaatgccagccgcacgcagctcatgtcgctcgcgaccctcgat
tgggacgaggcgatgctcggcgtgttccgcatcccgcgggcggtgctgccgacgatcgtc
tcctccagcgccgtgctgggcgaggcccgtgacccgtttcccggcgtaccgctcggcggc
attctgggcgatcagcaggcggccctgttcgggcagacctgcttctcggcgggcgaggcc
aagaacacctacggcaccggctgcttcgcgctgatgaacactggccccgcgcccgtcgcg
tcgagcgccgggctcatcaccaccgtggcctaccggctcgacgggcgcccgccggcctac
gcgctggagggctccattgccatcaccggcgccctggtgcagtggctgcgcgacaatctc
gggctgatcggcgcctcgagcgagatcgaggggctggcccgcagcgtcgaggacaatggc
ggcgtctacgtggtgccggcgttttccggcctctacgcgccgcattggcgcgacgacgcc
cgcggcctcatcatcggcctgacccgctacgccaatcgcggccacatcgcccgcgcctgc
ctggaggccaccgcctaccagacccgcgaggtgctggaggcgatggagcgcgattccggt
tgtccgatcgccgagttgcgctgcgacggcggcatgaccgtcaacgacctgctgatgcag
ttccaggccgacatcctcgaccggccgaccctgcgcccgaaggtgtcggagacgacagcc
ctgggcgcggcctatgccgctggcctcgccacagggttttggaagacactcgaagatctt
cgcgacaactgggccgtggacaagcgctggcatccgcatatccaggcagaagaacgtcgg
gcactgttcgccggctggagccgggccgtagaacgctcgttcggatgggtcgaggagaac
gcttga

DBGET integrated database retrieval system