KEGG   Methylobacterium extorquens CM4: Mchl_4493Help
Entry
Mchl_4493         CDS       T00809                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_4493
   00030 Pentose phosphate pathway
    Mchl_4493
   00051 Fructose and mannose metabolism
    Mchl_4493
   00052 Galactose metabolism
    Mchl_4493
   00500 Starch and sucrose metabolism
    Mchl_4493
   00520 Amino sugar and nucleotide sugar metabolism
    Mchl_4493
  Nucleotide metabolism
   00230 Purine metabolism
    Mchl_4493
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mchl_4493
Enzymes [BR:mch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mchl_4493
    5.4.2.8  phosphomannomutase
     Mchl_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4758121..4759644
Genome map
AA seq 507 aa AA seqDB search
MSFDTSKAFPTPVPKLEPNTFAFEQLPMVKPTGFREYDARWLFPQEINLMGVQALGLGLG
TLIHERGVRPDIVTGHDFRAYSASIKLALIAGMQAAGLRVKDIGLALSPMAYFGQFALDC
PCVAMVTASHNDNGWTGVKMGAERPMTFGPDEMGRLKEIVTTGAFQYRDGGAYEFVSDFA
QVYLDDLVARAKPVSRKLKVVAACGNGTAGAFAPALLERLGVEVIPLDVEPDHSFPRYNP
NPEDMAMLHAIADKVRETGADVGLGFDGDGDRCGVVDDEGEEIFADKIGVMLARDLSKLH
PNATFVVDVKSTGLYAADPELQARGVRTDYWKTGHSYIKRRVNELSALAGFEKSGHFFFN
APVGRGYDDGLLTAIAVIEMLDRNPGQTMADLYRALPKTWGSPTMSPHCADEVKYGVVDA
VTERFRALEASGEPVGGHPITSLVTVNGVRVTTADGTWGLVRASSNKPELVVVVESPVSE
ARLREMFAAVDGVLRQHPEVGAYNQTI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgatacctccaaggcctttcccacgcccgttccgaagcttgagcccaacacc
ttcgccttcgagcagttgccgatggtcaagcccaccggctttcgcgagtacgacgcccgc
tggctgttcccgcaggagatcaacctgatgggcgtccaggcgctcggcctcggcctcggc
acgctgatccatgagcgcggcgtgcgccccgacatcgtcaccggccacgactttcgcgcc
tactccgcctcgatcaagctcgcgctgatcgccgggatgcaggcggcgggcctgcgggta
aaggatatcgggctcgcactctcgccgatggcctatttcggccagttcgccctcgattgc
ccctgcgtggccatggtcaccgcctcgcacaacgacaacggctggaccggcgtgaagatg
ggcgccgagcgcccgatgactttcggccccgacgagatgggccgcctcaaggagatcgtc
accacgggcgcgttccagtaccgcgacggcggcgcctacgaattcgtctccgacttcgct
caggtctatctcgacgacctcgtggcgcgcgccaaacccgtctcgcgaaagctgaaggtc
gtggcggcctgcggcaacggcacggccggcgccttcgcgcccgcgctcttggagcggctc
ggcgtcgaggtgatcccgctcgatgtcgagccggatcacagcttcccgcgctacaacccg
aaccccgaggacatggcgatgctgcacgccatcgccgacaaggtgcgcgagaccggcgcc
gatgtcggcctcggcttcgacggcgacggcgaccgctgcggcgtggtcgatgacgagggc
gaggaaatcttcgccgacaagatcggcgtcatgctggcccgcgacctgtcgaagcttcac
ccgaacgcgaccttcgtggtcgacgtgaaatcgaccggcctctacgccgccgatcccgag
ttgcaggcccgcggcgtgcgcaccgactactggaagacgggccattcctacatcaagcgc
cgcgtcaacgagctctcggcgctggccggcttcgagaagtcgggccacttcttcttcaac
gcgccggtcggccgcggctacgacgacggcctgctcacggcgatcgcggtgatcgagatg
ctcgaccgcaatccggggcagaccatggccgacctctaccgggcgctgccgaagacctgg
ggctcgccgaccatgtcgccgcattgcgccgacgaggtgaagtacggcgtggtcgatgcg
gtgaccgagcggttccgggcgctcgaggcgtcgggcgagccggtgggcggccatcccatc
accagtctcgtgacggtcaacggcgtgcgcgtgaccaccgccgacggcacctgggggctg
gtgcgggcctcctcgaacaagccggaactcgtggtggtggtggagagcccggtctccgaa
gcgcggcttcgcgagatgttcgcggcggtggatggggtgctgcgccagcacccggaggtg
ggcgcctacaaccagacgatctga

DBGET integrated database retrieval system