KEGG   Methylobacterium extorquens CM4: Mchl_4640Help
Entry
Mchl_4640         CDS       T00809                                 

Definition
binding-protein-dependent transporters inner membrane component
Orthology
K15581  
oligopeptide transport system permease protein
Organism
mch  Methylobacterium extorquens CM4
Pathway
beta-Lactam resistance
ABC transporters
Brite
KEGG Orthology (KO) [BR:mch00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mchl_4640
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mchl_4640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4920470..4921393
Genome map
AA seq 307 aa AA seqDB search
MIPLILRRIAQSLPTLFLVVAGSFFLIRLAPGGPFDLERPLPPAAMENLRRVYGLDQPLI
VQFGRYLLSLLRGDLGPSFTFRDLTVTDLFARGLPVSVTLGGLALVLALGLGLALGSLAA
FNRNGTADRLVGLAASLGLAVPNFVTAPLLQIVFGLGLAWLPVGGWADGAPQNLVLPVLT
LALPHAAGIARLTRASLGEVLIQPHIRTQRAMGLSRARIARHALRGALLPVVATLGPLAA
GLMTGSVVVETIFGLPGIGRYFVEGALNRDYTLVMGTVILVAVMVIIFNLIADLIAAALD
PRVRLSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgatcctgcgccggatcgcccagagtctgccgaccctgttcctggtggtg
gcgggcagcttcttcctgatccggctggcgccgggcggcccgttcgatctggagcggccg
ctgccgccggcggcgatggaaaatctgcgccgggtctacggcctcgaccagccgctgatc
gtgcagttcgggcgctatctcctgagcctgctgcggggcgatctcgggccctccttcacc
tttcgcgatctcaccgtcaccgacctgttcgcgcgggggctgcccgtctccgtgacgctc
ggcggcctcgcgcttgtcctcgcgctgggcctcggcctcgcgctcgggagcctcgccgcc
ttcaaccgcaatgggaccgccgaccggctggtgggactcgccgcctcgctcgggcttgcg
gtgccgaatttcgtcaccgcgcccctgctccagatcgtgttcggcctcggcctcgcttgg
ctccccgtcggcggatgggcggacggcgcgccgcaaaacctcgtcctgccggtgctcact
ctcgctttgccccacgccgccggcatcgcccgtctcacccgcgcctcgctcggcgaggtg
ctgatccagccgcatatccgcacgcagcgcgccatggggctctcgcgtgcccgcatcgcc
cggcacgccctgcgcggggcgctgcttcccgtggtcgcgaccctcgggccgctggcggcg
gggctgatgaccggctcggtggtggtcgagaccatcttcggcctgcccggtatcggccgc
tacttcgtcgagggcgcgctcaaccgcgactacaccctggtgatgggcacggtgattctc
gtcgcggtgatggtgatcatcttcaacctcatcgccgacctcatcgccgccgccctcgac
ccgcgcgtgaggctttcggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system