KEGG   Methylobacterium extorquens CM4: Mchl_4640Help
Entry
Mchl_4640         CDS       T00809                                 

Definition
binding-protein-dependent transporters inner membrane component
Orthology
K15581  
oligopeptide transport system permease protein
Organism
mch  Methylobacterium extorquens CM4
Pathway
beta-Lactam resistance
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:mch02010]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mch00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4920470..4921393
Genome map
AA seq 307 aa AA seqDB search
MIPLILRRIAQSLPTLFLVVAGSFFLIRLAPGGPFDLERPLPPAAMENLRRVYGLDQPLI
VQFGRYLLSLLRGDLGPSFTFRDLTVTDLFARGLPVSVTLGGLALVLALGLGLALGSLAA
FNRNGTADRLVGLAASLGLAVPNFVTAPLLQIVFGLGLAWLPVGGWADGAPQNLVLPVLT
LALPHAAGIARLTRASLGEVLIQPHIRTQRAMGLSRARIARHALRGALLPVVATLGPLAA
GLMTGSVVVETIFGLPGIGRYFVEGALNRDYTLVMGTVILVAVMVIIFNLIADLIAAALD
PRVRLSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgatcctgcgccggatcgcccagagtctgccgaccctgttcctggtggtg
gcgggcagcttcttcctgatccggctggcgccgggcggcccgttcgatctggagcggccg
ctgccgccggcggcgatggaaaatctgcgccgggtctacggcctcgaccagccgctgatc
gtgcagttcgggcgctatctcctgagcctgctgcggggcgatctcgggccctccttcacc
tttcgcgatctcaccgtcaccgacctgttcgcgcgggggctgcccgtctccgtgacgctc
ggcggcctcgcgcttgtcctcgcgctgggcctcggcctcgcgctcgggagcctcgccgcc
ttcaaccgcaatgggaccgccgaccggctggtgggactcgccgcctcgctcgggcttgcg
gtgccgaatttcgtcaccgcgcccctgctccagatcgtgttcggcctcggcctcgcttgg
ctccccgtcggcggatgggcggacggcgcgccgcaaaacctcgtcctgccggtgctcact
ctcgctttgccccacgccgccggcatcgcccgtctcacccgcgcctcgctcggcgaggtg
ctgatccagccgcatatccgcacgcagcgcgccatggggctctcgcgtgcccgcatcgcc
cggcacgccctgcgcggggcgctgcttcccgtggtcgcgaccctcgggccgctggcggcg
gggctgatgaccggctcggtggtggtcgagaccatcttcggcctgcccggtatcggccgc
tacttcgtcgagggcgcgctcaaccgcgactacaccctggtgatgggcacggtgattctc
gtcgcggtgatggtgatcatcttcaacctcatcgccgacctcatcgccgccgccctcgac
ccgcgcgtgaggctttcggcatga

DBGET integrated database retrieval system