KEGG   Methylobacterium extorquens CM4: Mchl_4803Help
Entry
Mchl_4803         CDS       T00809                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mch00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5098995..5100152)
Genome map
AA seq 385 aa AA seqDB search
MMFGRPRAIAASLLLGLTLAPLQAMAEPAPIEAKPAAGATVGKAASVTAETLPMLNSLGQ
AGAWRSYKARFVTDQGRVVDTANGRISHSESQGYGLLLAVAAGDRDTFQRIWNWTRANLM
VRDDALLAWRWEPDKRPAVADMNDATDGDILVAWALVEAGEGWADDSYRLAARRIAVDIA
RRTVLFRTEGPPLLLPAMSGFSAEDRPDGPVINLSYWIFPAFPRLAAVAPEFDWDRLGAT
GRDLVLRARFGDAKLPTEWISMRGGQPQPASGFPPHFSYNALRVPLYLAMAGISERRYYE
PLLALWGEPDPAGLPIIDTEGGSVAGRMAEPGYAIIPALAACAVTGAPLPAGLQDPATDE
NYYPATLHLLALTAANMRYRPCLGR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcggccgcccacgcgccattgcagcctcgctgctcctaggcctgaccctcgcc
cccttgcaagcgatggcggagccggcgcccatcgaagcaaagccggccgccggagccacc
gtcgggaaggcggcctccgtgactgccgagacgctgccgatgctgaacagcctcggtcaa
gccggggcctggcgcagctacaaggcgcgcttcgtcaccgatcagggccgcgtagtcgac
acggccaacggccgcatcagccatagcgagagccagggctacggcctgctgctcgccgta
gcggccggcgatcgcgacaccttccagcggatctggaattggacgcgggccaatctgatg
gtgcgcgacgacgcgctgctggcctggcgctgggagccggacaagcggcccgccgtagcc
gacatgaacgacgcgacggacggcgacatcctcgtggcctgggcgctggtcgaggcgggc
gagggctgggcggatgatagctaccgcttggcggcccgccggatcgccgtggacatcgcc
cgccggacggtcctcttccgcacggagggccctccgctcctgctgccggccatgagcggg
ttctcggcggaggaccggccggacgggccggttatcaatctctcctactggatcttcccg
gccttcccgcgactcgccgctgtcgcgccggaattcgactgggaccggctcggcgcgact
ggtcgggacctcgtcctgcgggcccgcttcggcgatgcgaaacttccgaccgagtggatc
tcgatgcggggcggccagccccagcccgcatccggcttcccgccccacttctcctacaac
gccctgcgggtgcccctctacctcgccatggcgggcatcagcgagcgacgctactacgag
ccgctgttggccctctggggcgagccggacccggccggactgccgatcattgacacggag
ggcgggtctgttgcgggacgcatggccgagcccggctacgcgatcatcccggccctggcc
gcctgcgcggtgaccggtgcgccgctgccggccggcctgcaggacccggccaccgacgag
aactactatcccgccaccctccacctcctggccttgacggccgccaacatgaggtatcgg
ccatgcctcggccgctga

DBGET integrated database retrieval system