KEGG   Methylobacterium extorquens CM4: Mchl_4862Help
Entry
Mchl_4862         CDS       T00809                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mchl_4862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_4862
   00052 Galactose metabolism
    Mchl_4862
   00500 Starch and sucrose metabolism
    Mchl_4862
   00520 Amino sugar and nucleotide sugar metabolism
    Mchl_4862
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mchl_4862
   00524 Butirosin and neomycin biosynthesis
    Mchl_4862
Enzymes [BR:mch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mchl_4862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5174685..5175686)
Genome map
AA seq 333 aa AA seqDB search
MFEFPVLIGDIGGTNARFGLIETRGAPPRLLSREATHGHPDPSAAIRASLAQGGGPAPRS
AILAIAGRVDAPAVQLTNADWLVDAAAIARDFGLARVALVNDYVPVAAGAAGIAPDDLTP
IGPSRGDASGPRLVLGPGTGFGAAALIPYEDRLAIVSTEAGHTDLGPTDAEEFEIWPAVE
RVEGRVTVETLLSGPGLARICAAIRAVRAGGDGSLCDPAEITSSGLSGEDPHAHAALALF
SKLLGRVCGDLALTFLATGGVYIGGGIAPRIVSVLREGAFREAFERKAPFAEQMRIIPTS
VITVKDPAFSGLAALASESERFVYHGHAWTPQK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaattcccggtgctgatcggcgatatcggcgggaccaatgcccgcttcggcctg
atcgaaacgcggggggcgccgccccgtctcctctcgcgcgaggcgacgcacggccatccc
gatccgagcgcggcgatccgggcctccctggcgcagggcggcgggcccgcgccgcgctcg
gcgatcctggcgatcgcgggccgggtcgatgcgccggcggtccagctcaccaacgcggac
tggctggtggacgccgccgcgatcgcccgtgatttcgggctcgcgcgggtcgcccttgtc
aacgattacgtgccagtcgccgcgggcgcggccggcatcgcgcccgacgacctcacgccg
atcggtccaagtcgcggtgacgcaagcgggccgcgcctcgtgctcgggccgggcaccggc
ttcggcgccgccgccctgatcccctacgaggaccgcctcgccatcgtctcgacggaggcc
ggccacaccgatctcgggccgaccgacgcggaggagttcgagatctggccggcggtcgag
cgcgtcgaggggcgggtcacggtggagacgctgctctccggtcccggtctcgcccggatc
tgtgcggcgatccgcgcggtgcgggcgggcggcgacggttcgctgtgcgacccggccgag
atcacgagcagcggcctctcgggcgaggatccgcatgcacacgccgcgctcgcgctgttc
agcaagctgctcggccgggtatgcggggatctggcgctgaccttccttgccaccggcggg
gtctatatcggcggcggcatcgccccgcggatcgtctccgtcctgcgggagggtgcgttc
cgcgaggctttcgagcgcaaggcgcctttcgccgagcagatgcgcatcatccccaccagc
gtcatcaccgtgaaggaccccgccttcagcggcctcgcggccctggcgagcgagagcgag
cgcttcgtctatcacgggcatgcctggacaccgcagaagtaa

DBGET integrated database retrieval system