KEGG   Methylobacterium extorquens CM4: Mchl_4898Help
Entry
Mchl_4898         CDS       T00809                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00010  Glycolysis / Gluconeogenesis
mch00620  Pyruvate metabolism
mch00640  Propanoate metabolism
mch00680  Methane metabolism
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
mch01130  Biosynthesis of antibiotics
mch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_4898
   00620 Pyruvate metabolism
    Mchl_4898
   00640 Propanoate metabolism
    Mchl_4898
  Energy metabolism
   00680 Methane metabolism
    Mchl_4898
Enzymes [BR:mch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mchl_4898
Lipid biosynthesis proteins [BR:mch01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mchl_4898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACK85663
UniProt: B7KSJ5
Position
complement(5213729..5215417)
Genome map
AA seq 562 aa AA seqDB search
MQRAREEEAAPAERRRKFEEVAVPERADRYETLVRDFRWEIPERYNIAADVCDRWALSEP
DRTALLVLGPDDRPEPVSYGRLRSDSLRLAAALAARGVGPGDRVAVLLPQSVAVVVTHFA
AYRLGAIALPLAGLFGEAALRHRLADSGACAVVTDAPGLTKLERLRADLPDLATILSVDG
AGEAAEDFFAALESAPDGFATRATGPDDPALMIYTSGTTGLAKGALHGHRVLLGHLPGWG
VMHGFPPEGTGLMWTPSDWAWAGGLLNVLMPSLRLGMPVVAKASGRFEPETAFRLMADLG
ITHAFLPPTALRMLRGVADPRQRFDLSALRNIASAGEALGAETFDWARDALGLTIGEAYG
QTECNLVLASSAQIGVARAGATGKPVPGHRVAVLREDGTEADADETGEIAVRAPDPVLFL
GYWRQPEATAKKFRDGWWMTGDQARRDADGYIRFVGREDDLITSAAYRIGPAEIEACLCA
HPAVALAAAVGVPDPLRTETVKAFVTLRAGFSPSEALAAEILAFAKARLSAHEVPRALAF
RDTLPMTTSGKIIRRQLRDEPA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgcccgggaggaagaggcggcaccggccgagcgccgccgcaagttcgaggaa
gttgccgtgccggagcgggccgatcgctacgagacgctcgtcagggatttccgctgggag
atcccggagcgctacaacatcgcggccgatgtctgcgaccgctgggcgctgagcgagccc
gaccgcaccgcgctcctcgtgctcggccccgacgaccggcccgagccggtgagctacggc
cgcctgcgctccgattcgctgcggctcgcggcggcgctggccgcgcgcggcgtcgggccg
ggcgaccgggtggcggtgctgctgccgcaatcggtggcggtggtggtgacccatttcgcc
gcctaccggctcggggcgatcgcactcccgctcgccggcctgttcggtgaggcggccctg
cgccatcgcctcgccgattccggcgcctgcgccgtcgtcaccgacgcgcccgggctgacc
aagctggagcggctgcgcgccgacctgccggatcttgccacgatcctctcggtcgatggg
gcaggggaggccgcggaggatttcttcgcggctctggagagcgccccggacgggttcgcg
acgcgggcgaccgggccagacgatccggccctgatgatctacacctccggcacgaccggc
ctcgccaagggggcgctgcacggccaccgggtcctgctcggccacctgccgggctggggc
gtgatgcacggcttcccgcccgagggaaccgggctgatgtggacgccctccgactgggcc
tgggccgggggcctgctcaacgtgctgatgccgtccctgcgcctcggcatgccggtggtc
gcgaaggcctcgggccggttcgagccggagacggcgttccggctgatggcggatctcggc
atcacccacgccttcctgccgccgacggctttgcgcatgctgcgcggggtggccgatccg
cgccaaagattcgacctctcagccctgcgcaacatcgcctccgccggcgaggcgctcggg
gccgagaccttcgattgggcgcgtgacgccctcggcctcaccatcggcgaggcctatggc
cagaccgagtgcaacctcgttctcgcctccagcgcccagatcggcgtcgcgcgggctggc
gcgacgggcaagccggtgcccggccaccgcgtcgcggtcctgcgcgaggacgggaccgag
gcggacgcggacgagaccggcgagatcgccgtgcgcgccccagatccggtgctgttcctc
ggctactggcgccagcccgaggcgaccgccaagaaatttcgcgacggctggtggatgacc
ggcgaccaagcacggcgcgacgccgacggctacatccgcttcgtcggccgcgaggacgat
ctcatcacctccgcggcctaccggatcggcccggcggagatcgaggcctgcctctgcgcc
catccggcggtggcactcgccgccgcggtgggcgtgcccgatccgctgcgcaccgagacc
gtgaaggccttcgtcaccctgcgcgcgggtttttcgccctccgaggcgctggccgccgaa
atcctcgccttcgccaaggcccggctctccgcccacgaggtgccgcgcgcgctcgcgttt
cgcgacaccctgccgatgacgacgagcggcaagatcatccggcggcagttgcgggacgag
ccggcctaa

DBGET integrated database retrieval system