KEGG   Methylobacterium extorquens CM4: Mchl_4910Help
Entry
Mchl_4910         CDS       T00809                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mchl_4910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mchl_4910
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mchl_4910
Enzymes [BR:mch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mchl_4910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5232080..5232922)
Genome map
AA seq 280 aa AA seqDB search
MTARIDAAFARCRAEGRAALVTYVMAGDPDPETSLKVLEALPKAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQDLRGTLALVRRFREGDDQTPVVLMGYYNPIHTYGVPHFLEDAQ
AAGIDGLIVVDLPPEEDEELCLPALEKGLAFIRLATPTTDEARLPAVLANTAGFVYYVSI
TGVTGTATPDFGRVSQAVSRITAHTNLPVVVGFGVKTGAHAAEIARGADGVVVGSALVDA
LARSLEPGDRAGSGTVEAVASLVRELAQGVRSAAKAPAGA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcgatgccgccttcgcccgctgccgcgcggaaggacgtgccgccctc
gtcacctacgtgatggcgggcgatcccgatccggagacctcgcttaaggtgctcgaagcc
ctaccgaaggcgggggccgacatcgtcgagttcggcctgcccttcaccgatcccatggcc
gacgggccggcgatccaggcggcgggtctgcgggcgctgaaggcgggccaggatctgcgc
ggcaccctcgccctcgtccgccgcttccgcgaaggcgacgaccagacgcccgtggttctg
atgggctactacaacccgatccatacctacggcgtgccccacttcctggaggatgcgcag
gcggccggcatcgacggtctgatcgtcgtcgatctgccgccggaggaggacgaggagctc
tgcctgccggcgctcgaaaaggggctcgccttcatccgcctcgcgaccccgaccacggac
gaggcccgcctgccggcggttctcgcgaacaccgcgggcttcgtctactacgtgtcgatc
accggcgtgaccggcacggcgacccccgatttcggccgggtgtcgcaggcggtcagccgg
atcacggcgcatacgaacctgcccgtcgtcgtcggcttcggcgtgaagaccggcgcgcac
gccgccgagatcgcccgcggcgccgacggcgtggtggtgggctcggccctcgtcgatgcc
ctggcccgcagcctcgaacccggcgaccgggccgggagcggcacggtggaggcggtcgcc
tccctggtgcgcgagctggcgcagggggtccgcagcgccgccaaagcgccggccggggcc
tga

DBGET integrated database retrieval system