KEGG   Methylobacterium extorquens CM4: Mchl_5017Help
Entry
Mchl_5017         CDS       T00809                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mchl_5017
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mchl_5017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5360862..5361854
Genome map
AA seq 330 aa AA seqDB search
MLTLRPTPGNPVPPGARLVPVETADGVSLRAATWQPTTRGVKGTVCLLQGRAEFIEKYFE
TISDLRARGFCVVAFDWRGQGDSGRQVRDAHKGHVRHFDDYRLDLKAITETVLVPMMPEP
HFGLAHSMGGAVALTLAAEGRLPFRRLVTVAPMLAIRMVRWPAGASLLARGLQRLGLGRC
YIPFGTAVSIATKPFAGNRLSTDPVRYARNAEAARAVGAGAVGDPTIAWLAAAFRAMRRL
ADPALIRRIRTPCLIVAAGADPVCSTPAVERFAARLKTGHLIVLPGARHEILTECDAVRA
DFWAAFDAFIPGHLVHSTAGEAAPHATVAG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccctgcgtcccacccccggtaatccggtgccacccggcgcccgcctcgtgccg
gtcgagaccgccgacggcgtctccttgcgggccgcgacgtggcagccgacgacgcggggc
gtgaagggcacggtctgcctgcttcagggccgggccgagttcatcgagaagtatttcgag
acgatcagcgacctgcgtgcccgcggcttctgcgtggtcgccttcgactggcgcggccag
ggcgattccggccgtcaggtccgcgacgcccacaaggggcatgtccgccacttcgatgat
taccgtctcgacctgaaggcgatcaccgagaccgtgctcgtgccgatgatgcccgagccg
catttcgggctcgcccattccatgggcggggcggtggcgctgacactcgcggcggagggc
cggctgccgttccggcggctcgtcaccgtcgctccgatgctggcgatccgcatggtgcgc
tggccggcgggcgcctcgctgctggcgcggggcctgcagcggctcgggctcgggcgctgc
tacatccccttcggcacggccgtctcgatcgccacgaagccgttcgccggcaatcgcctc
tcgaccgatccggtgcgctatgcccgcaacgccgaggccgcccgcgcggtcggggccggt
gcggtcggcgatccgaccatcgcctggctcgccgccgccttccgggcgatgcggcggctg
gcggacccggcgctgatccggcggatccgcacgccctgcctgatcgtcgcggcgggcgcc
gacccggtctgcagcacgccggcggtcgagcgcttcgccgcccggctcaagaccgggcac
ctgatcgtgttgccgggcgcccgccacgagatcctgaccgagtgcgacgcggtccgcgcc
gatttctgggcggccttcgacgcgttcatccccggccatctcgtccattcgaccgccggc
gaagccgctcctcacgccaccgtcgccggctaa

DBGET integrated database retrieval system