KEGG   Methylobacterium extorquens CM4: Mchl_5017Help
Entry
Mchl_5017         CDS       T00809                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mch00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5360862..5361854
Genome map
AA seq 330 aa AA seqDB search
MLTLRPTPGNPVPPGARLVPVETADGVSLRAATWQPTTRGVKGTVCLLQGRAEFIEKYFE
TISDLRARGFCVVAFDWRGQGDSGRQVRDAHKGHVRHFDDYRLDLKAITETVLVPMMPEP
HFGLAHSMGGAVALTLAAEGRLPFRRLVTVAPMLAIRMVRWPAGASLLARGLQRLGLGRC
YIPFGTAVSIATKPFAGNRLSTDPVRYARNAEAARAVGAGAVGDPTIAWLAAAFRAMRRL
ADPALIRRIRTPCLIVAAGADPVCSTPAVERFAARLKTGHLIVLPGARHEILTECDAVRA
DFWAAFDAFIPGHLVHSTAGEAAPHATVAG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccctgcgtcccacccccggtaatccggtgccacccggcgcccgcctcgtgccg
gtcgagaccgccgacggcgtctccttgcgggccgcgacgtggcagccgacgacgcggggc
gtgaagggcacggtctgcctgcttcagggccgggccgagttcatcgagaagtatttcgag
acgatcagcgacctgcgtgcccgcggcttctgcgtggtcgccttcgactggcgcggccag
ggcgattccggccgtcaggtccgcgacgcccacaaggggcatgtccgccacttcgatgat
taccgtctcgacctgaaggcgatcaccgagaccgtgctcgtgccgatgatgcccgagccg
catttcgggctcgcccattccatgggcggggcggtggcgctgacactcgcggcggagggc
cggctgccgttccggcggctcgtcaccgtcgctccgatgctggcgatccgcatggtgcgc
tggccggcgggcgcctcgctgctggcgcggggcctgcagcggctcgggctcgggcgctgc
tacatccccttcggcacggccgtctcgatcgccacgaagccgttcgccggcaatcgcctc
tcgaccgatccggtgcgctatgcccgcaacgccgaggccgcccgcgcggtcggggccggt
gcggtcggcgatccgaccatcgcctggctcgccgccgccttccgggcgatgcggcggctg
gcggacccggcgctgatccggcggatccgcacgccctgcctgatcgtcgcggcgggcgcc
gacccggtctgcagcacgccggcggtcgagcgcttcgccgcccggctcaagaccgggcac
ctgatcgtgttgccgggcgcccgccacgagatcctgaccgagtgcgacgcggtccgcgcc
gatttctgggcggccttcgacgcgttcatccccggccatctcgtccattcgaccgccggc
gaagccgctcctcacgccaccgtcgccggctaa

DBGET integrated database retrieval system