KEGG   Methylobacterium extorquens CM4: Mchl_5129Help
Entry
Mchl_5129         CDS       T00809                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mchl_5129
   01230 Biosynthesis of amino acids
    Mchl_5129
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_5129
   00051 Fructose and mannose metabolism
    Mchl_5129
   00562 Inositol phosphate metabolism
    Mchl_5129
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mchl_5129
Enzymes [BR:mch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mchl_5129
Exosome [BR:mch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mchl_5129
  Exosomal proteins of bladder cancer cells
   Mchl_5129
  Exosomal proteins of melanoma cells
   Mchl_5129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5493067..5493831)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLLSSVPTVEAIRDGLSPALADKIDVLICPPATLISSCVAAVY
GSVVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGADTVIAYEPVWAIGSGRT
PTATEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgctc
tcctcggtcccgaccgtcgaggcgatccgtgacgggctctcgccggcgctcgcggataag
atcgacgtgctgatctgcccgcccgcgacgctgatctcctcctgcgtggcggcggtctac
ggctccgtggtcgccatcggcggccagaacctgcacgcccggccgagcggcgccttcacc
ggttcgatctcggcggagatgttcgccgatctcggcgccacctacgtcatcgtcggccat
tccgagcggcgcgcctaccattacgagaccgatgacggcgtccacgccaaggcgctcggc
gctcgccgcgcgggcctgcgcggcatcatctgcgtcggcgagacgatggaggagcgccag
cagggccgggcgctcgacatcgtccgcgcgcagctcgccatcggcctgccgaagggtgcg
accggcgccgacaccgtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgacggagatcgccgaggtccacgcctccttgcgcgagatgctcgacaagctc
gtcggcgaggaggcgcacaagatccgcatcctctacggcggctcggtgaagccctcgaac
gcccgcgaactgatggcggtggagaacgtcgacggcgcgctggtcggcggcgccagcctc
gtggcggaggactttttggggatctgccgcgcctacgaggggtga

DBGET integrated database retrieval system