KEGG   Methylobacterium extorquens CM4: Mchl_5135Help
Entry
Mchl_5135         CDS       T00809                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01130  Biosynthesis of antibiotics
mch01230  Biosynthesis of amino acids
Module
mch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mchl_5135
Enzymes [BR:mch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mchl_5135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACK85899
UniProt: B7KUW0
Position
5501269..5502126
Genome map
AA seq 285 aa AA seqDB search
MDDIVADVTVGPATSTPERASVLARIEAYKRREIAEAKLRLPLAKLEKQVAKADPPRGFA
DAIARHIGEGRPALIAEIKKASPSKGLIRADFDPKTLAKAYAKGGATCLSVLTDTPSFQG
APDFLIEARAACDLPVLRKDFMFEPYQVYEARAWGADCILVIMACLDDAEAAAITETAHD
LGMDVLVEVHDAQELERALPLGTRLVGVNNRNLKTFEVSFETAITLKPGIPADRIAVAES
GIGGHADVLRLKQHGLNTVLVGESLMRQDDVTAATRALLFGEQGR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgtggccgacgtgaccgtcgggcctgccacctcgaccccggagcgggcg
agcgtgctggcccggatcgaggcctataagcgccgcgaaatcgccgaggcgaagctgcgt
ctgccgctggccaagctggaaaagcaggtcgctaaagccgacccgccccgcggctttgcc
gacgccatcgcccggcatatcggggaaggccgtccggccctgatcgccgagatcaagaag
gcctcgccctccaaggggctgatccgcgccgatttcgacccgaagacgctggccaaggcc
tacgcaaagggcggcgccacctgtctctcggtgctgaccgacacgccctccttccagggc
gcaccggacttcctgatcgaggcgcgcgcggcctgcgacctgccggtcctgcgaaaagac
ttcatgttcgagccgtatcaggtctacgaggcccgcgcctggggcgccgattgcatcctc
gtcatcatggcctgcctcgatgacgcggaggccgccgccatcaccgagaccgcgcacgat
ctcggcatggatgtgctggtcgaggtccacgacgcgcaggagctggagcgggccctgccg
ctcggcacccgtctggtcggcgtcaacaaccgcaacctcaagaccttcgaggtctcgttc
gagaccgcgatcaccctgaagcccggcatccccgccgaccggatcgcggtggccgagagc
ggcatcggcggacatgccgacgtgctgcggctgaagcagcacgggctcaacaccgtcctc
gtcggcgagagcctgatgcggcaggacgacgtgaccgcggcgacgcgggccctgctgttc
ggggagcagggccggtga

DBGET integrated database retrieval system