KEGG   Methylobacterium extorquens CM4: Mchl_5162Help
Entry
Mchl_5162         CDS       T00809                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mch  Methylobacterium extorquens CM4
Brite
Enzymes [BR:mch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mchl_5162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5532900..5533550)
Genome map
AA seq 216 aa AA seqDB search
MLDYAQARRLMVDCQLRTFDVNDVAVLDAFDTVPRERFVPPGREDFAYIDQTLTFDTGAD
GIRAMPAPMLLARLIQALKIRPGTRALDVGTGYGYGAAMLRQLGAEVVALESDPDLIGAA
RERLGDTVNLVQGALTAPAKGGPFDAILVEGRVEVRPQALLDQLRDDGRLVCVLGPHRNA
KATLFVRAGDAFGARPLFDASLPALKSFATEPGFAF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattatgctcaggcgcggcgcctcatggtcgattgtcagctccggaccttcgat
gtgaacgacgtcgcggtgctcgatgccttcgacaccgtaccccgcgagcgcttcgtcccg
ccgggccgcgaggatttcgcctatatcgaccagacgctgaccttcgatacgggcgcggac
gggattcgcgcgatgcccgccccgatgctgctggcgcgcctgattcaggcactcaagatc
cgtccgggcacccgcgccctcgatgtcggcaccggctacggctacggcgcggccatgctc
cggcagctcggcgccgaagtcgtcgccctggaatccgacccggatctcatcggcgccgcc
cgcgagcgcctcggcgacacggtcaacctcgtccagggcgccttgaccgctccggccaag
ggtgggcctttcgacgccatcctcgtcgaggggcgagtcgaggtccggccgcaggccctg
ctcgatcaattgcgcgatgacgggcgcttggtctgcgtgctcggtccgcaccgcaacgcc
aaggcgaccctgttcgtgcgggcgggcgatgccttcggggcccgcccgctcttcgatgcc
tcgctgccggccctgaagagcttcgcgaccgaacccggcttcgcgttctga

DBGET integrated database retrieval system