KEGG   Methylobacterium extorquens CM4: Mchl_5195Help
Entry
Mchl_5195         CDS       T00809                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mch00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mch00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5559669..5561078
Genome map
AA seq 469 aa AA seqDB search
MAAISFLGDLIQTISDRGRDLIGLARSDLARTASAADLTRFCEDLISRRGEASGVALARL
ILDRYAAFPLEDRLAFLELIATEFGADHDAVDAAIAAYRADPTRARLGLLHVAAEPRSQE
LIRRLNLARGGTLALVRMREDLFTLRKRLKDREAAPETIDAAVSLDSDFEHLFASWFNRG
FLVLRPIDWSTPADILEKIIRYEAVHEIADWDELRRRIQPTDRRCFAFFHPALLDEPLIF
VEVALTNAIAPAIQPILADGREPVPARSATTAIFYSISNCQKGLAGVTFGNFLIKQVVED
LAREIPSLKTFVTLSPVPGFRTWLDRERGADAPQGLTREDVEALRLLDTEDWRSDKTKCE
AVRRAMLPAAAAYFLRAKNDRGRPLDPVARFHLGNGARLERMNFLGDTSKKGLKQSYGLM
VNYLYDLSAIEKNHETYVNLGTVATSSAVSRELRSNLPPPRAVVLAEAG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatctcgttcctcggcgatctcatccagaccatcagtgaccggggccgggac
ctcatcggcttggcccgctccgatctggcgcggacagcgagcgcggccgacctcacccgg
ttctgcgaagacctgatctcccggcgcggcgaagcctcgggcgtggcgctcgcgcgcttg
atcctcgatcgctacgccgcctttccccttgaggaccggctcgccttcctcgaactcatc
gccaccgaattcggtgccgaccatgacgcggtcgatgccgcgatcgccgcttaccgtgcc
gatccgacgcgggcccgactcggtctgttgcacgtggcggccgagccgcgctcgcaggaa
ttgattcggcggctcaacctcgcccgcggcggcaccctggcgctggtgcggatgcgcgag
gatctgttcacgctgcgcaagcgcctgaaggatcgggaagccgccccggagacgatcgac
gcggcggtgagcctcgacagcgatttcgagcacctgttcgcctcttggttcaatcggggc
ttcctcgttttgcgcccgatcgactggtcgacgccggccgacatcctcgaaaagatcatc
cgctacgaggcggtccacgagatcgccgattgggacgagttgcgccgccgcatccagccg
acggaccggcgctgtttcgccttcttccacccggccctgctcgacgagccgctgattttc
gtcgaggtggcgctcaccaacgccattgctccagcgatccagccgatcctggccgatgga
cgcgaaccggtgcccgcgcgcagcgccacaaccgcgatcttctactcgatttcgaactgt
cagaagggcttggccggcgtcaccttcggcaacttcctcatcaagcaggtggtcgaggat
ctcgcccgcgagattccctcgctgaaaaccttcgtcaccctctcgccggtgcccggcttc
cgcacttggctcgaccgggagcgtggcgccgacgcgccgcagggcctgacgcgggaggat
gtcgaggcgctgcgcctgctcgataccgaggattggcgcagcgacaaaacgaagtgcgag
gcggtgcggcgcgccatgctgcccgcggcggcggcctatttcctgcgcgccaagaacgac
aggggtcgcccgctcgatccggtggctcgcttccatctcggcaacggcgcccggctggag
cggatgaacttcctcggcgacacttcgaagaagggcctgaagcagtcctacgggctgatg
gtgaactacctctacgacctctcggcgatcgagaagaaccacgagacctacgtcaatctc
ggcaccgtcgcgacctcctcggcggtcagccgcgaactgcgctccaacctgccgccgccg
cgggcggtggtgctggccgaggcgggctga

DBGET integrated database retrieval system