KEGG   Methylobacterium extorquens CM4: Mchl_5197Help
Entry
Mchl_5197         CDS       T00809                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mchl_5197
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mchl_5197
Enzymes [BR:mch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mchl_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5561725..5562510)
Genome map
AA seq 261 aa AA seqDB search
MSLQGKAAVVTGSTSGIGLAIAKSFAKDGANVVLNGFGNPEDIERTRSGIESEFGVKAVY
SPADLTKPDEIGGLIALSVETFGSIDILVNNAGIQYVSPIEDFPVEKWDQIIALNLCSAF
HTLRAAVPHMKAKGWGRVINTASAHSMVASPYKSAYVAAKHGVVGLTKTAALELATHGIT
VNCISPGYVWTPLVESQIPDTMKARGLTKEQVIEEVLLKAQPTKEFVTIDQVAALALFLC
TDSASQITGANIAMDGGWTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcaagggaaagccgccgtggtcaccggctcgacgagcggcatcggcctcgcc
atcgccaagagcttcgccaaagacggcgcgaacgtggtcctcaacggattcggcaacccc
gaggacatcgagcggacccgaagcggcatcgagagcgagttcggggtcaaggcggtctat
tcgcccgccgacctcaccaagccggacgagatcggcgggctgatcgcactctcggtcgag
acgttcggcagcatcgacatcctcgtgaacaatgcgggcatccagtacgtctcgccgatc
gaggactttccggtcgagaagtgggaccagatcatcgccctcaatctctgctcggccttt
cacaccctgcgtgcggccgtgccgcacatgaaggcgaagggctggggccgggtcatcaac
acggcctcggcgcactcgatggtcgcctcgccctacaagtcggcctacgtcgcggccaag
cacggcgtcgtcggcctcaccaagacggcggcgctcgaactcgccacccacggcatcacg
gtgaactgcatctcaccgggctatgtctggacgccgctggtggagagccagatcccggac
acgatgaaggcgcgcggcctcaccaaggagcaggtgatcgaggaggtgctgctcaaggcg
cagccgaccaaggaattcgtgacgatcgatcaggtggccgcgctcgccctgttcctgtgc
acggacagcgccagccagatcaccggtgccaacatcgccatggatggcggctggacggcg
cagtag

DBGET integrated database retrieval system