KEGG   Methylobacterium extorquens CM4: Mchl_5281Help
Entry
Mchl_5281         CDS       T00809                                 

Gene name
bchH
Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mchl_5281 (bchH)
Enzymes [BR:mch01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mchl_5281 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5653613..5657329)
Genome map
AA seq 1238 aa AA seqDB search
MPRRISADRPTIRVAIVTLDNHLASAVERARLRLAAEMPGLALSFHAAAEWETDKAALRA
CEAEIARADIVLSAMLFLDEHVQAILPAIQARRESCDAMIGCLSASEIVRTTKLNRFDMS
GTKRSALDFLKRLRGKPGAEGNAARQMALVRKLPKILRFIPGSAQDVRAYFLTLQYWLAG
SDENVASLVRFLVQRYAAGPRAVWREIAAAPAPQHYPETGLYHPRMADRVGESLSALPTV
PGARGRVGLLLMRSYVLAGNTAHYDGVIAALEAKGLCVVPAFAAGLDNRPAVDAYFTVNG
RPAIDALVSLTGFSLVGGPAYNDAAAAEATLARLDVPYLAAHALEFQTIEQWEAGSRGLS
PVEATMMVAIPELDGATAPMVFGGRSSASGPGNARDMRVHPERAERLATRIDRLVSLRRR
PKGERRLAVILFNFPPNAGATGTAAFLSVYASLLNTLRGLKAEGYDVAVPDSVDALRETI
LGGNATRYGTQANVHARVSAEDHVRRETYLAEIEAQWGPAPGRHQSNGADILVLGAQFGN
VFVGVQPAFGYEGDPMRLLFEQGFAPTHAFSAFYRWLREDFSADAVLHFGTHGALEFMPG
KQAGLSEACWPERLIGALPNIYLYAANNPSEGTIAKRRSAATLVSYLTPSLAAAGLYRGL
SDLKASVERWRGLEPEATVERTALAVVIQAQGAAVDLIPAEPVWEGNPAPHVAALAAALF
ELEQTLIPHGLHVIGQGMVGEERVDLLLALAEASHGLKPARAGIELLIEGASLSEALAAA
ALPADETHRAAFADLARIDADLARDSELPALMRALDGRFVAPVAGGDLLRNPGLLPTGRN
LHGFDPYRLPTAFALADGTRQVARVLERYLDEGRALPESVALVLWGTDNLKSEGGPIAQA
LALIGAAPRFDGYSRLAGAELIPLEQLRRPRIDAVVTLSGIFRDLLPLQTKLLAEASFLA
ASAEEPIERNFVRKHALAIQAEQGCDFETAALRVFSNAEGAYGANVNHLVESGRWDDEDE
LCETFSRRKSFAYGRTGRPAPQRDLMKAVLARVDLAYQNLDSVELGVTSVDHYFDGLGGM
GRAVARARGEAVPIYISDQTRGEGRVRSLDEQVALETRTRMLNPKWYEGLLGHGYEGVRQ
IEATLTNTVGWSATAGAVQPWIYERITETFVLDDAMRDRMATHNPTACAKVASRLIEAHR
RGFWTPDPAMRDALDRAEEELEDRLEGVTPGITAGVAA
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcgcatttcggccgataggcctaccatccgcgtcgccatcgtcacgctcgac
aatcacttggcgagcgcggtggaacgggcgcgcctgcggctcgcggcagagatgccgggg
ctcgccctgagctttcacgccgccgcggagtgggagaccgacaaggccgcgctccgggcc
tgcgaggcggagatcgcacgcgccgacatcgtcctctcggcgatgctgttcctcgacgag
cacgtccaggcgatcctgccggcgatccaggcacgccgcgagagctgcgacgcgatgatc
ggctgcctctcggcctccgagatcgtacggacgaccaagctcaaccgcttcgacatgagc
gggaccaagcgctcggccctcgacttcctgaagcggctgcgcggcaagccgggcgcggaa
ggcaacgccgcccggcagatggcgctggtgcgcaagctgccgaagatcctgcgcttcatc
cccggctcggcgcaggacgtgcgcgcctatttcctcaccctgcaatactggctcgcgggc
tcggacgagaacgtggcgagcctcgtgcgcttcctcgtccagcgctacgccgccggcccc
cgcgccgtgtggcgggagatcgccgcggcgccagcacctcagcactatcccgagaccggc
ctctaccatccgcgcatggccgaccgcgtcggcgagagcctgtccgccctgccgaccgtg
ccgggcgcccgcggccgcgtcggcctgctgctgatgcgctcctacgtgctggccggcaac
acggcgcattacgacggggtcatcgccgccctggaggccaagggcctctgcgtggtgccg
gcctttgccgccggcctcgacaaccgcccagcggtggacgcctatttcacggtgaacggc
cggccggcgatcgacgcactggtctcgctcaccgggttctcgctggtcggcggcccggcc
tacaacgacgcggcggcggccgaggcgacgctggcgcggctcgacgtgccttatctcgcc
gcccacgcgctggaatttcagaccatcgagcaatgggaggcgggcagccgcggcctttcg
ccggtcgaagcgaccatgatggtcgcgatccccgaactcgacggcgccaccgcaccgatg
gtgttcggcggccgttcctcggcttccggccccggcaacgcccgcgacatgcgcgtgcat
cccgagcgcgccgagcggctcgccacccggatcgatcggctcgtgtccctgcggcgccgg
ccgaagggcgagcggcgtctggccgtcatcctgttcaacttcccgcccaatgccggcgcc
accggcacggccgccttcctctcggtctacgcctcgctgctgaacaccctgcgcggcctc
aaggccgagggctacgacgtcgccgtgcccgacagcgtcgatgcgttgcgtgagacgatt
ctcggcggcaacgccacccgctacggcacgcaggccaacgtccacgcccgcgtttcggcc
gaggatcacgtccgccgcgagacctacctggccgagatcgaggcgcaatggggcccggcg
cccggacgccaccagagcaacggggccgacatcctcgtgctcggcgcgcagttcggcaac
gtcttcgtcggggtgcagcccgccttcggctacgagggcgacccgatgcggctgctgttc
gagcagggcttcgcgccgacccacgccttcagcgccttctaccgctggctgcgcgaggac
ttttccgccgacgcggtgctgcatttcggcacccacggcgcgctcgaattcatgccgggc
aagcaggccggattgtcggaagcctgctggcccgagcggctgatcggtgcgctgccgaac
atctacctctacgccgccaacaacccgtccgagggcacgatcgccaagcgccgctccgcc
gcgacgctcgtgagctacctcacgccgagcctcgccgccgccgggctctaccgcggcttg
agcgacctcaaggcctcggttgagcgctggcgcggtttggagccggaagcgacggttgag
cggacagcgctcgccgtggtcatccaggcccagggcgcggccgtcgatctgatcccggcc
gagcccgtctgggagggcaaccccgccccgcacgtcgccgcgctcgccgccgctttgttc
gaactcgagcagacgctgatcccgcacggcctgcacgtgatcggccaggggatggtcggc
gaagaacgtgtcgatctactgctcgccctggcggaggcctcgcacgggctgaagccggcc
cgcgccgggatcgagctcctgatcgagggcgcgtccctcagcgaggcgctagccgccgcg
gctctacccgccgatgagacccatcgagccgccttcgccgacctcgcccggatcgatgcc
gacctcgcccgcgacagcgagctgcccgcgctgatgcgggccctcgacgggcgcttcgtg
gccccggtcgcgggcggcgacctgctgcgcaatcccggtctcctgcccacggggcgcaac
ctgcacggcttcgacccctaccgcctgcccacggccttcgcgctggccgacggcacccgc
caagtggcacgggtgctggagcgttacctcgacgaaggccgggccctgccggagagcgtc
gcgctcgtcctgtggggcaccgacaacctgaagagcgagggcggccccatcgcccaggcg
ctagcgctgatcggcgcggcgccccgcttcgacggctacagccgcctcgccggggccgag
ctgatcccgctcgaacaactccgccgcccgcgcatcgacgcggtggtcacgctgtcgggc
atctttcgcgatcttctgcccctgcaaaccaagctgctcgcggaagcgagctttctggcg
gcgagcgccgaggagccgatcgagcggaacttcgtgcgcaagcacgccctggcgatccag
gccgagcagggctgcgacttcgagacggcggccctgcgggtcttctccaatgccgagggc
gcctacggcgccaacgtgaaccatctcgtcgagtccggccgctgggacgacgaggacgaa
ctctgcgagaccttttcgcgccgcaagagcttcgcctacggccgcaccggccgccccgcg
ccgcagcgtgacctgatgaaggcggtgctggcccgggtcgatctcgcctaccagaacctc
gattcggtcgaactcggtgtcacgagcgtcgatcactacttcgacgggctcggtggcatg
ggccgggcagtggcccgcgcccgcggcgaggcggtgccgatctacatcagcgaccagacc
cgcggggaggggcgcgtgcgctcgctcgacgagcaggtggcgctggaaacccgcacccgc
atgctcaacccgaaatggtacgagggcctgctcggccacggctatgagggcgtgcgccaa
atcgaagcgacgctgaccaacaccgtcggctggtccgccaccgccggcgcggtgcagccc
tggatctacgagcgcatcaccgagaccttcgtcctcgacgatgccatgcgcgaccggatg
gcgacgcacaaccccacggcctgcgccaaggtcgccagccgcctgatcgaggctcaccgc
cgcggcttttggactcccgacccggcgatgcgcgacgcgctcgaccgtgccgaggaggaa
ctggaggaccggctggagggcgtgacacccggcatcaccgcaggagtcgcggcatga

DBGET integrated database retrieval system