KEGG   Methylobacterium extorquens CM4: Mchl_5460Help
Entry
Mchl_5460         CDS       T00809                                 

Definition
phosphoserine aminotransferase (EC:2.6.1.52)
Orthology
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mchl_5460
   01230 Biosynthesis of amino acids
    Mchl_5460
  Energy metabolism
   00680 Methane metabolism
    Mchl_5460
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mchl_5460
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mchl_5460
Enzymes [BR:mch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     Mchl_5460
Amino acid related enzymes [BR:mch01007]
 Aminotransferase (transaminase)
  Class V
   Mchl_5460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pMCHL01:complement(85214..86371)
Genome map
AA seq 385 aa AA seqDB search
MPDRPAARPRVPYFSSGPTTKRPGWSLDALSGAALGRSHRSAVGKAKLAEAIELTRKVLR
IPADYRIGIVPGSDTGAVEMAMWSMLGPKPVEVMAWDSFGAEWVTDALKELRIDPKVHIG
EHGILPKLDAIDTKNNDVVFTWNGTTAGVKVPHADWIADDREGVMICDATSAAFAMPLPW
DKLDVVTYSWQKVMGGEAAHGMLILSPRAVARLESHTPAWPIPKVFRLTKGGKLLEGIFK
GETINTPSMLAVEDYLDTLKWAQSIGGLDALHARADANARVIHDWVARTPWIGHLAVDPA
TYSNTGVCLVITDPDVLAKGDAVVKKVAAGIVTRLESEGVAFDFGAYRDAPAGLRIWCGA
TVEASDLAALTPWLDWAFAQEQRQL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgccggatcgccccgccgcgcgcccgcgcgtgccttacttttcgtccggccccacgacc
aagcgtcccggctggagcctcgatgccctctccggtgccgcgctcggccgctcgcaccgc
tcggccgtcggcaaggccaagctcgccgaagccatcgagctgacccgcaaggttctgcgc
atccccgccgattaccgtatcggcatcgtccccggctccgataccggcgccgtcgagatg
gcgatgtggtcgatgctcggcccgaagcccgtcgaggtgatggcctgggattccttcggt
gccgagtgggtcaccgatgcgctcaaggaactccggatcgacccgaaggtgcatatcggc
gagcacggcatcctgcccaagctcgacgccatcgacaccaagaacaacgacgtcgtcttc
acctggaacggcaccaccgccggcgtgaaggtcccgcacgccgactggatcgccgacgac
cgcgagggcgtcatgatctgcgacgcgacctcggccgccttcgcgatgccgctgccgtgg
gacaagctcgatgtcgtcacctattcctggcagaaggtgatgggcggcgaggccgcgcac
ggcatgctgatcctctcgccgcgcgccgtcgcgcgcctcgagagccacacgccggcttgg
ccgatcccgaaggtgttccgcctgaccaagggcggcaagctgctcgagggcatcttcaag
ggcgagaccatcaacacgccctcgatgctggcggtcgaggactacctcgacaccctgaaa
tgggcgcagagcatcggcggcctcgacgcgcttcatgcgcgggcggacgccaatgcgcgg
gtgatccatgactgggtggcacgcaccccctggatcggccacctcgcggtggatccggcg
acctactcgaacacgggtgtgtgcctcgtgatcaccgacccggacgtgctcgccaagggc
gacgccgtggtcaagaaggttgccgccggcatcgtcacgcggctggagagcgagggcgtc
gccttcgacttcggcgcctaccgcgatgcaccggccggcctacgcatctggtgcggcgcc
accgtggaagcgtccgacctcgcagcgctcaccccctggctcgactgggccttcgcccag
gaacaacgacagctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system