KEGG   Momordica charantia (bitter melon): 111011145Help
Entry
111011145         CDS       T05045                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00052  Galactose metabolism
mcha00500  Starch and sucrose metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111011145
   00500 Starch and sucrose metabolism
    111011145
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111011145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 111011145
NCBI-ProteinID: XP_022140495
Position
Unknown
AA seq 564 aa AA seqDB search
MKKPLIWVVPLFFWLAYYGVEAASYQPYRTAFHFQPPKNWMNDPNGPMYYKGVYHLFYQY
NPYSAIWGNITWAHSXSYDLVDWVHLEHALYPTEPYEVNGCWSGSATIILGEKPAILYTG
ANFKNQQFQNLAVPKNPSDPLLKEWIKSPHNPLIVPVDDIDPQNFRDPTTAWLGSDGLWR
VIVGGEIGGRGMAILYRSKDFVDWTRSKSPLHTSTETGMWECPDFYPVSINGSNGLDTSA
EGKLVKHVLKASFHDNDHYVLGSYVRETDTFSVETDFLSNGSDMRYDYGKFYASKSFYDS
DKERRILWGWIKESDSEADDIGKGWSGLQSIPRSILLXESGKQLVQWPIKEIEKLRTKQV
SFDDMDLKSGSVFEVPGITAAQADIEILFRLSGLKESEEMNVSWIDPQLLCKENKASVNG
MIGPFGLLVLASKELTEQTAVYFRVLRKQYDKYAVLMCSDQSRSSLREGLEKTTYGAFVD
IDPLHETLSLRSLIDHSIIESFGGNGKACITARVYPNLAINQDAHLYAFNNGTVDVRISK
LSGWSMKKAQIVPIQKRRKKAPTS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacccttaatttgggttgttccactgttcttttggctggcttattatggagtt
gaagcagcctcttatcagccctacagaaccgcctttcacttccagcctcctaaaaattgg
atgaatgatcccaatggaccgatgtattataagggggtttaccatctgttctatcagtat
aatccttacagtgcaatttggggcaacattacttgggcccattcartatcatatgatctt
gttgattgggttcatttggagcatgctctgtatccaacagaaccgtatgaagtcaatggt
tgctggtctggttctgcaacaattattcttggtgaaaaaccagctatcttgtacactgga
gccaacttcaaaaatcagcaatttcaaaatttagctgttcctaagaatccgtctgaccct
ctactgaaggagtggattaaatcccctcataatcctctgattgtccctgttgatgacatt
gatcctcagaattttagggacccaacgactgcttggctaggctcagatgggttatggagg
gtcattgttggaggggagattggtggtcgtggaatggcgattctgtaccgcagtaaggat
ttcgttgattggactcggagtaagagtccgcttcatacatcaaccgaaaccgggatgtgg
gagtgcccggatttttatccggtgagtatcaatggtagtaatggacttgacacttctgct
gagggtaagttagtaaagcatgtgctcaaggcaagttttcatgacaatgaccactatgta
ctgggaagttacgtgcgagaaacggacacattttcagttgaaactgacttcttgagcaat
ggatctgatatgcgatacgattacgggaaattctatgcttccaaatcattttatgatagt
gataaggagagaagaatattgtggggatggataaaggaatcagatagcgaagcagatgat
attggcaaaggatggtctggccttcagtcaattcctagaagtattttgcttgrtgaatct
gggaaacaattggtgcaatggccgattaaagaaatcgagaaactacggacaaagcaagtg
agttttgatgatatggacctcaaaagtggttcagtatttgaagtcccgggtattacggcc
gctcaggccgatatcgaaattttgttccgcttatctggtctcaaagaatcagaagagatg
aacgtgagttggattgatccacaattgctctgtaaagaaaataaagcatcagtgaatggc
atgattggaccattcggattgttggtcttggcttctaargaattgacagaacaaactgca
gtctactttcgagtattaaggaagcaatacgacaaatatgctgtgctcatgtgcagtgat
caaagcaggtcttctctgagggaagggcttgagaaaaccacttatggagcattcgtcgac
atagaccctcttcatgaaacgctctccttaagaagcctgatagaccattccataatcgaa
agttttggtggaaatgggaaggcctgcatcactgcaagagtgtatccaaatttggccatc
aaccaagatgcccatctttatgcattcaacaatggaactgtggatgtaagaatttcaaag
cttagtggttggagcatgaagaaagcccagattgttcccatccaaaagagaagaaaaaag
gcacccacttcttga

DBGET integrated database retrieval system