KEGG   Mesorhizobium ciceri: Mesci_0055Help
Entry
Mesci_0055        CDS       T01401                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mci  Mesorhizobium ciceri
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mci03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(58755..59360)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLSPLAAAMAEAADKVRIC
STCGNVDTSDPCMICTDPRRDAGTIIVVEDVSDLWALERAAAMNVRYHVLGGTLSPLDGI
GPEQLNMRSLVDRVAGGEVKEIILAVNATVEGQTTAHYLTDQLSGFDIKVTRLAHGVPVG
GELDYLDEGTLAAALRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcgaatcgccggtcccgagatcgaacgtctgatccagctcctggccaaggtg
ccggggctgggaccccgttcggccaggcgtgccgcccttcatctgatcaagaagaaagag
cagcttttgtcgccccttgccgccgccatggccgaggcggccgacaaggtgcgcatctgc
tcgacctgcggcaatgtcgatacatcggacccttgcatgatctgcaccgatccgcgccgt
gatgccggcaccatcatcgtcgtcgaggacgtctccgacctgtgggcgctggagcgcgcg
gcggcgatgaatgtgcgctaccacgtgctcggcggcacgctgtcgccgctcgacggcatc
ggccccgagcaactcaacatgcgctcgctggttgatcgcgtcgccggcggcgaggtcaag
gagatcatcctcgccgtcaatgcgacggtggagggccagacgaccgcgcattacctcacc
gaccagttgtccggcttcgacatcaaggtgacgcgccttgcgcatggcgtgccggtaggc
ggcgaactcgactatctcgacgagggcacgctggccgcggcgctgcgttcgcggacggcg
ttttga

DBGET integrated database retrieval system