KEGG   Mesorhizobium ciceri: Mesci_0065Help
Entry
Mesci_0065        CDS       T01401                                 

Definition
(RefSeq) cytochrome C class I
  KO
K08738  cytochrome c
Organism
mci  Mesorhizobium ciceri
Pathway
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
mci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mci00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesci_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 10115505
NCBI-ProteinID: YP_004139289
UniProt: E8TMT4
Position
67217..67894
Genome map
AA seq 225 aa AA seqDB search
MDSNEVNKLLAGLLGTVFVVFSVGIVSDALFASPAPEKPGFAIEAAEPAEGGPAAPAAAA
KPIADLLATANVEQGAAVFKKCQACHSGEKGGPNKVGPDLWDLVDRPVAEHEGFAYSAGM
KEFSKGGTEKWTYDNINHFITSPKKFVKGTAMGFAGLPKDEDRANVIAYLRTLSDNPKPL
PAPGAAADAGAKPADAAAPAKPAEGAAPAAPAAPAPAAPAPAPAQ
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacgaagtcaacaagctgctcgccggattgctcggaaccgttttcgtcgtc
ttctcggtcggcattgtgtccgatgcgctgtttgcgtcgccggcgccggaaaagcctggt
ttcgccatcgaggccgccgagcccgccgaaggcggtccggccgcgcctgccgcggcggcc
aagccgatcgccgacctgctggcgaccgccaatgtcgagcagggtgctgccgtcttcaag
aagtgccaggcctgccattccggcgaaaagggcggccccaacaaggtcggcccggacctg
tgggacctcgtcgaccgcccggtcgccgagcatgaaggctttgcctattcggccggcatg
aaggaattctccaagggcggcaccgagaagtggacctacgacaacatcaaccacttcatc
acctcgccgaagaaattcgtgaaaggcaccgccatgggcttcgccggcctgcccaaggac
gaggaccgcgccaacgtcatcgcctatctgcgcacgctgtccgacaatcccaagccgctg
ccggcaccaggggctgccgccgatgcaggcgccaagcctgccgatgcagccgctccggca
aagccggctgagggtgccgcgccggccgctcccgccgccccggctccggccgcaccggca
ccggcgcctgcccaataa

DBGET integrated database retrieval system