KEGG   Mesorhizobium ciceri: Mesci_0410Help
Entry
Mesci_0410        CDS       T01401                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_0410
   01230 Biosynthesis of amino acids
    Mesci_0410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_0410
   00030 Pentose phosphate pathway
    Mesci_0410
   00051 Fructose and mannose metabolism
    Mesci_0410
   00052 Galactose metabolism
    Mesci_0410
  Energy metabolism
   00680 Methane metabolism
    Mesci_0410
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mesci_0410
Protein phosphatases and associated proteins [BR:mci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mesci_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(452707..453873)
Genome map
AA seq 388 aa AA seqDB search
MAGTFVIAQGGGPTAVINQTVVGATLEIRKRHPGAKVLGSIHGVRGIRDGNYVDLSAIPE
DRLRLIAGTPSAALGSTRDKPDAAYCDVILNGLKKAGADAFIYIGGNDTSGTQQILTDAA
GGSIAFVHAPKTIDNDLEENDHTPGFISAAEFVAGAFLSVDLDFRALPGIYVGIVMGRHA
GFLTAAAAAWQLDPDSGPHLVYVPERPFSAAGFIDDVRATLDRHKRCIVAVSEGVSTADG
KALVESLVPPDKLERDAHGNVKLSGSDLPAALERALAEGLPGKRARVDALGYMPRGYIGA
ISAVDAQEAFDAGAFAVTVAEQGGGSVALQYDGTRTVLKKVPLKNVAGKTRHMPDDFMKP
DVNQLSDAGMAYLKRLVPEKYKVGKPFV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggctggaacgtttgtcatcgcgcagggcggcggcccaaccgccgtcatcaaccagacg
gttgtcggggcgacgctggagatccgcaagcggcatcccggtgccaaggtgctgggctcg
atccatggcgtgcgcggcatccgtgacggcaattatgtcgacctttccgccattccggaa
gaccgcctgcggctgattgccggcacgccgagcgccgccctcggctcgacgcgcgacaag
cccgacgccgcctattgcgatgtcatcctcaacggcctgaagaaggccggcgccgacgcc
ttcatatatatcggcggcaacgacacgtcgggtacccagcagatcctgaccgacgctgcc
ggcggctcaattgcctttgttcatgcgccaaaaaccatcgacaatgatctcgaggaaaac
gaccacacgccgggctttatttcggcggccgagttcgtcgccggcgccttcctgtccgtc
gatctcgattttcgcgcgctgcccggcatctatgtcggcatcgtcatgggccgacatgcc
ggcttcctgaccgcggccgcggctgcctggcagctcgaccccgacagcggccctcatctc
gtctacgtgcccgagcgcccattctcggccgctggcttcatcgacgacgtgcgtgccacg
ctcgatcgccacaagcgctgcatcgtcgccgtttcggaaggcgtcagcaccgccgacggc
aaggcattggtcgaaagcctggtgccgccggacaagcttgagcgcgacgcgcatggcaac
gtcaagctgtcgggcagcgacctgccggccgcactcgagcgcgcgttggcggaaggcctg
cccggcaagcgtgcccgcgtcgacgcgctcggctacatgccgcgcggctatatcggcgcc
atcagcgcggtcgacgcgcaggaggctttcgatgccggcgctttcgccgtcaccgtcgcc
gaacagggcggcggctcggtggcgctgcaatatgacggcaccagaacggtgctgaagaaa
gtgccgctcaagaacgtcgccggcaagacccgccacatgcctgacgatttcatgaagccc
gacgtcaatcagctgtcggatgccggcatggcctatctcaagcggctggtgccggaaaag
tacaaggtcgggaagcccttcgtctga

DBGET integrated database retrieval system