KEGG   Mesorhizobium ciceri: Mesci_0418Help
Entry
Mesci_0418        CDS       T01401                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mci  Mesorhizobium ciceri
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mci00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mci00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
462257..463582
Genome map
AA seq 441 aa AA seqDB search
MSSGFFGDIQKIKYEGPDSTNPLAYRFYNPDEVVAGKRLEDHLRFAVAYWHSFAWPGGDP
FGGQTFDRPWFPKAGGVDTMELAKLKADVAFEMFSLLGAPYFCFHDADVRPEGKDFSESA
ARLDEIADYFAGKMKQTGVKLLWGTANLFSNRRFMSGAATNPDPDVFAYAAATVKSCIDV
TKRLKGENYVLWGGREGYETLLNTDLAREQEQAGRFLSIVVDYKHKIGFKGTILIEPKPQ
EPTKHQYDYDVATVYGFLKRFGLEKEVKVNIEQGHAILAGHSFEHELALANALGIFGSID
MNRNDYQSGWDTDQFPNNVPEMALAYYQVLQAGGFKTGGTNFDAKLRRQSLDPQDLLIGH
IGGMDSCARGLKAAARMVEDKALSAPLAERYAGWNTAEGKAMLAGKRTLEDIAERVVKKK
IEPQPRSGRQELLENIVNRYV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggatttttcggcgacatccagaagatcaaatatgaagggccggattcgacc
aatccgctggcctataggttctacaatcccgatgaggtcgtcgccggcaagcggctggaa
gatcatctgcgcttcgccgttgcctactggcactcctttgcctggccgggtggcgatccg
ttcggcggccagactttcgaccggccgtggtttcccaaggccggcggcgtcgacacgatg
gagctggcaaaactgaaagcagacgtcgccttcgagatgttctcgttgctcggcgcgccc
tacttctgcttccacgacgccgatgtacggccggaaggcaaggatttttccgagagtgcg
gcgcgcctcgatgagatcgccgactacttcgcgggcaagatgaagcagaccggcgtcaag
ctgctttggggcaccgccaatctgttctccaaccgccgcttcatgtcgggcgcggccacc
aatcccgatccggatgtctttgcctacgcggcggcgacggtgaaaagctgtatcgacgtc
accaagcggctgaagggcgaaaactacgtgctgtggggcgggcgcgaaggctatgagacc
ctgctcaacaccgaccttgcgcgcgagcaggaacaggccggccggttcctcagcatagtc
gtcgactacaagcacaagatcggcttcaagggcacgatcctgatcgagccgaagccgcag
gagccaaccaagcatcagtacgattacgatgtcgccacggtctacggcttcctcaagcgc
ttcgggctggagaaggaggtcaaggtcaatatcgagcagggccacgccatcctggccggc
cattccttcgagcacgaactggctctggccaatgcgctcggcattttcggttcgatcgat
atgaatcgcaacgactaccagtcgggctgggacaccgaccagttccccaacaacgtgccg
gaaatggcactggcctactaccaagtcctgcaggctggcggcttcaagaccggcggcacc
aatttcgacgccaagctgcgccgccagtcgctcgatccgcaggacctgctgatcggccat
atcggcggcatggactcttgcgctcgcggcctgaaagccgcggcgcgcatggtcgaggac
aaggcactgtcggcgccgctggccgaacgctatgccggctggaacacggccgagggcaag
gcgatgcttgccggcaagcgcacgcttgaggatatcgccgagcgtgtcgtcaagaagaag
atcgagccgcagccgaggtccggccgccaggaactgctggaaaacatcgtcaaccgctac
gtgtag

DBGET integrated database retrieval system