KEGG   Mesorhizobium ciceri: Mesci_0450Help
Entry
Mesci_0450        CDS       T01401                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesci_0450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesci_0450
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesci_0450
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesci_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
491702..492952
Genome map
AA seq 416 aa AA seqDB search
MNKPATPNSFRTGPDEQGMFGIFGGRFVAETLMPLILDLERHWNEVKNDADFRAELTDLS
THYAGRPSKLYFAEGLTKHLREVSSARGLAGGAKVYFKREDLNHTGSHKINNCLGQILLA
KRMGKKRIIAETGAGQHGVASATVAARFGFPCVVYMGATDVARQSPNVFRMKLLGAEVRP
VTAGHGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGIEARAQILE
QEGRLPDTIIAAVGGGSNAIGLFHPFLDDKEVRIIGIEAGGRGLDGIEHCASMNAGAPGV
LHGNRTYLLQNSDGQIMDGHSISAGLDYPGVGPEHSWLRDSGRVEYVPILDDEALEAFKL
TTRVEGIIPALESAHAIAHAVKIVPAMDKDQIVIVNLSGRGDKDVHTVASMLGMEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggcgacacccaattccttccgcaccgggcccgacgaacagggcatgttc
ggcattttcggcggtcgtttcgttgccgaaacgctgatgccgctgatcctcgatctggag
cggcactggaacgaggtcaagaacgatgcggatttcagggctgagctgactgacctgtcg
acccactatgccggacggccgtcgaagctttatttcgccgaaggcctcacgaagcatctt
cgtgaggtttcctcggccaggggcctcgcgggcggcgcgaaggtctacttcaagcgggag
gatttgaaccacaccggttcgcacaagatcaacaactgcctcggccagatcctgctggcc
aagcgcatgggcaagaagcgcatcatcgccgagaccggcgccggccagcacggcgtggcc
tcggccacggttgcggcccgcttcggctttccctgcgtcgtctacatgggcgccacagac
gttgcccggcaaagcccgaacgtcttccgcatgaagctgctcggcgccgaagtgcgcccg
gtgaccgccggccacggcacgctgaaggacgccatgaacgaggcgttgcgcgactgggtc
accaatgtcgaggacacctattacctgatcggcaccgccgccggcccgcatccctatccg
gagctggtgcgcgacttccagtcggtgatcggcatcgaggcgcgggcacagatcctcgag
caggaaggccggctgcccgacaccatcatcgccgctgtcggcggtggttcgaacgccatc
ggcctgttccatcccttcctcgacgacaaggaggtccgcatcatcggcatcgaagccggc
ggtcgcggtctcgacggcatcgagcattgcgcctcgatgaatgccggcgcgccgggcgtg
ctgcatggcaaccgcacctatctcctgcagaattccgacggccagatcatggacggccat
tcgatctcggccggcctcgactatcccggcgtcgggccggagcattcctggctgcgcgat
tcaggccgggtcgaatacgtgccgatcctcgatgacgaggcgctggaggctttcaagctg
acgacgcgcgtcgaaggcatcatcccggcgctggaatcggcgcatgccatcgcgcatgcg
gtgaagatcgtgcctgccatggacaaggatcagatcgtcatcgtcaacctgtccggccgt
ggcgacaaagacgtgcacacggtggcttcgatgctgggcatggagatctga

DBGET integrated database retrieval system