KEGG   Mesorhizobium ciceri: Mesci_0451Help
Entry
Mesci_0451        CDS       T01401                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesci_0451
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesci_0451
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesci_0451
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesci_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
492955..493794
Genome map
AA seq 279 aa AA seqDB search
MATRIDRRMAKLRNEGRPALVTYFMGGDPDYDTSLSIMKALPGAGSDIIELGMPFSDPMA
DGPAIQAAGLRALKGGQTLAKTLKMAADFRAGDNETPIVLMGYYNPIYIYGVDRFLKDAI
ASGIDGLIVVDLPPEMDEELCIPALKAGINFIRLATPTTDDKRLPKVLQNTSGFVYYVSM
TGITGSALADTGKVAAAVKRIKGHTDLPVCVGFGVKTAEQARVIGANADGVVVGTAIVNA
VANVLGPKGEKTADPAEAVATLVSGLAQGVRSARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggccacccgcatcgaccgccgcatggcgaagctcaggaacgaaggccgcccggcgctc
gtcacctatttcatgggcggcgaccccgactacgacacctctttgtcgatcatgaaggcg
ttgccgggcgcaggttccgatattatcgagctcggcatgccgttttccgatccgatggcc
gacggcccggcgatccaggcggcgggcttgcgggcgctgaaaggcggccagacgctggcc
aagacgctgaagatggcggccgacttccgcgccggcgacaatgaaacgccgatcgtgctg
atgggctactacaatccgatctacatctatggcgtcgaccgcttcctcaaggacgcgatc
gccagcggcatcgacgggctgattgtcgtcgacctgcccccggagatggatgaggaactg
tgcattccggcattgaaagccggcatcaacttcatccggctggcgacgccgaccaccgac
gacaaacgcctgcccaaggtgctgcagaacacgtcgggcttcgtctattacgtgtcgatg
accggcatcaccggctcggcgctggccgacaccggcaaggtggcggcggcggtcaagcgc
atcaagggccacaccgacctgccggtctgcgtcggcttcggcgtcaagaccgccgagcag
gcccgggtgatcggcgccaatgccgacggcgtcgtcgtcggcaccgcgatcgtcaatgcg
gtggccaatgtgctggggccgaagggcgagaagaccgccgatccggccgaggccgtcgcc
acgctggtcagcgggcttgcgcaaggcgtgcgctcggcccgccttgctgctgccgaatag

DBGET integrated database retrieval system