KEGG   Mesorhizobium ciceri: Mesci_0451Help
Entry
Mesci_0451        CDS       T01401                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesci_0451
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesci_0451
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesci_0451
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesci_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
492955..493794
Genome map
AA seq 279 aa AA seqDB search
MATRIDRRMAKLRNEGRPALVTYFMGGDPDYDTSLSIMKALPGAGSDIIELGMPFSDPMA
DGPAIQAAGLRALKGGQTLAKTLKMAADFRAGDNETPIVLMGYYNPIYIYGVDRFLKDAI
ASGIDGLIVVDLPPEMDEELCIPALKAGINFIRLATPTTDDKRLPKVLQNTSGFVYYVSM
TGITGSALADTGKVAAAVKRIKGHTDLPVCVGFGVKTAEQARVIGANADGVVVGTAIVNA
VANVLGPKGEKTADPAEAVATLVSGLAQGVRSARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggccacccgcatcgaccgccgcatggcgaagctcaggaacgaaggccgcccggcgctc
gtcacctatttcatgggcggcgaccccgactacgacacctctttgtcgatcatgaaggcg
ttgccgggcgcaggttccgatattatcgagctcggcatgccgttttccgatccgatggcc
gacggcccggcgatccaggcggcgggcttgcgggcgctgaaaggcggccagacgctggcc
aagacgctgaagatggcggccgacttccgcgccggcgacaatgaaacgccgatcgtgctg
atgggctactacaatccgatctacatctatggcgtcgaccgcttcctcaaggacgcgatc
gccagcggcatcgacgggctgattgtcgtcgacctgcccccggagatggatgaggaactg
tgcattccggcattgaaagccggcatcaacttcatccggctggcgacgccgaccaccgac
gacaaacgcctgcccaaggtgctgcagaacacgtcgggcttcgtctattacgtgtcgatg
accggcatcaccggctcggcgctggccgacaccggcaaggtggcggcggcggtcaagcgc
atcaagggccacaccgacctgccggtctgcgtcggcttcggcgtcaagaccgccgagcag
gcccgggtgatcggcgccaatgccgacggcgtcgtcgtcggcaccgcgatcgtcaatgcg
gtggccaatgtgctggggccgaagggcgagaagaccgccgatccggccgaggccgtcgcc
acgctggtcagcgggcttgcgcaaggcgtgcgctcggcccgccttgctgctgccgaatag

DBGET integrated database retrieval system