KEGG   Mesorhizobium ciceri: Mesci_0477Help
Entry
Mesci_0477        CDS       T01401                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesci_0477
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mesci_0477
Enzymes [BR:mci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mesci_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(520906..521742)
Genome map
AA seq 278 aa AA seqDB search
MKISIILASYDSGHYHGGMGQGPDALISGGLVDALTMAGHDVTVEDIGRVGDIQEREIAT
GFAVCNAVATEVRLARDAGRFPIVLAGNCLTSAGAVAGEDADAIIWADQHGDLNTPETSA
YGFLDGMALATVLGLCWRPMASAIPGFKPIDPSRCVLVNARDLDPDEKRLLETLPIVRTE
CSGVAQATERLKIAGAKRVHMHLDMDVHDPRELQANRYITSGGPSPEQLRDATCAMALAV
PVVGITVSAYDPAFDAQADVPPLVGQLLNDLIATIEGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatctccatcatcctggcctcctacgacagcggtcattaccatggcggcatgggc
cagggcccggacgcactgatatcaggcgggctcgtcgacgcgctgaccatggccggccat
gacgttacggtggaagacatcggcagggtcggagacatccaggagcgcgagatcgccacc
ggctttgctgtctgcaacgcggttgcgaccgaggttcgccttgcccgtgacgccggccgg
tttcccatcgtccttgcgggaaactgcctgacatcagccggtgcggtcgccggcgaggac
gccgatgcgatcatctgggccgaccagcatggcgacctcaacacgcccgagacatcggca
tacgggtttctcgacggcatggcgctggcgacggtgcttggcctgtgctggaggccgatg
gcgtcggccattcccggcttcaagccgatcgatccgtcgcgttgcgtgctcgtcaacgcc
cgcgatctcgatccggacgagaagcggctgctggagacgctgccgatcgtgcggacggaa
tgctccggggtggcccaggcgaccgaaagactgaagatcgccggcgccaaacgcgtgcac
atgcacctcgatatggacgtgcatgatccccgcgagttgcaggccaaccgctatatcact
tcgggcggcccgagcccggagcagttgcgcgacgccacttgcgccatggcgcttgcggtg
ccggtcgtcggcatcaccgtctccgcctacgatccggctttcgacgcgcaggccgatgtt
ccgccgctggtcggccagttgctgaacgatctcatcgccacgatagagggccgctga

DBGET integrated database retrieval system