KEGG   Mesorhizobium ciceri: Mesci_0607Help
Entry
Mesci_0607        CDS       T01401                                 

Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00300  Lysine biosynthesis
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
mci01230  Biosynthesis of amino acids
Module
mci_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mesci_0607
Enzymes [BR:mci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mesci_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 10116050
NCBI-ProteinID: YP_004139829
UniProt: E8TDK0
Position
complement(645044..646237)
Genome map
AA seq 397 aa AA seqDB search
MTLPTDPAENLAALIRCASVTPAEGGALTALETMLKPLGFLVDRPVFSEDGTPDIENLYA
RRSGNGPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFIAAVA
RHVEANGGPKGSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASVVGEPTNPDALGDM
IKIGRRGSMSGAVTVNGRQGHVAYPLLADNPVRGLMSLVDALLHPVFDKGTRDFQPTNLE
ITSIDVGNPATNVIPAKATATFNIRFNDTWTDETLQAEIHNRLDQAARRKKYRQGKKTPV
DYELVWRDRPSHVFLTRDDRLIETLRGSIKSAVGKEPTLSTSGGTSDARFIKDYCPVVEF
GLVGKTMHMVDERVAIADLETLTQIYQRFIEDWFGQG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccgaccgatcctgccgaaaacctcgccgcccttatccgttgcgcttcggtg
acgcccgctgagggcggtgcgctgaccgcgctggagacgatgctcaaaccgctcggcttc
ctggtcgatcggccggtgttttccgaagacggcacgcccgatatcgaaaacctctatgca
aggcgttccggcaatggcccgcatctgatgttcgccggccacaccgacgtggtgccggtc
ggcgacgaagccgcctggacgcatccgcccttcgccgccgagatcgccaatggcgagatg
tatggccgcggcgccgtcgacatgaagggcggcatcgcctgtttcatcgccgccgtggcg
cgccatgtcgaggccaatggcggtccgaaaggctcggtctcgctgctgatcaccggcgac
gaggaaggccccgcgatcaacggcacggtcaagctgctcgaatgggcggcttccaggggc
gagaaatgggatgcctctgtcgtcggcgagccgaccaacccggatgcgctgggcgacatg
atcaagatcggccgccgcggctcgatgtccggcgccgtcaccgtcaatggccgccagggc
catgtcgcctatcccttgcttgccgacaatccggtgcgcgggctgatgagcctggtcgat
gccttgctgcatccggttttcgacaagggaaccagggatttccagccgaccaatctggag
atcacctccatcgatgtgggcaacccggccaccaatgtcatcccggccaaagcgaccgcg
accttcaacatccgcttcaacgacacctggacggacgagaccctgcaggccgaaatccac
aaccggctcgaccaggcggccaggcgcaagaagtaccggcagggcaagaagacgccggtc
gactacgagctcgtctggcgcgaccggccgagccatgtcttcctgacccgtgacgacagg
ctgatcgaaacgctgcgcggctcgatcaagtcggcggtcggcaaggagccgacgctgtcg
acctccggtggaacctccgatgcgcgtttcatcaaggactattgcccggtggtcgagttc
gggctggtcggcaagaccatgcacatggtcgacgagcgcgtcgccattgccgacctcgag
acgctgacgcaaatctaccagcgcttcatagaagactggttcggacagggctga

DBGET integrated database retrieval system