KEGG   Mesorhizobium ciceri: Mesci_0739Help
Entry
Mesci_0739        CDS       T01401                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00620  Pyruvate metabolism
mci00630  Glyoxylate and dicarboxylate metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01200  Carbon metabolism
Module
mci_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesci_0739
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_0739
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mesci_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 10116183
NCBI-ProteinID: YP_004139959
UniProt: E8TFM9
Position
complement(785220..787388)
Genome map
AA seq 722 aa AA seqDB search
MTDRIEIAGLRIARELHEFVAREALPGTGIEADAFWNGFSAIVHDLAPKNRELLAKRDAI
QEQIDGWYRDHGAPVDMEAYKGFLKGIGYLVPEGPAFSVSTDNVDPEIADVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKAFNPARGAKVVAWTKTFLDEAAP
LTSGKWAGVNGLSLAQGALRLSAGAGSTTLADPRQFVGYRGDAANPDAVLLVRNGLHIEI
VIDRNNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAPDKVVVYRNWLGLMKGDLAE
EITKGGKSFVRKLNPDRAYTAPAGGTLTVPGRSLMLVRNVGHLMTSPAILDRDGNEVPEG
IMDAAMTALIALHDVGPNGRRANSRAGSMYVVKPKMHGPDEVAFAVEMFDRVEALLGMAK
NTIKMGIMDEERRTTVNLKEAIRAAKERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLVEKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKNRPKARLDDILSVPVAVRPNWSPDDIQKELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLHHGVCSEDQVMATMKR
MADIVDRQNEGDPLYEPMAADFDKSIAFLAACDLVFKGRAQPNGYTEPVLHARRLELKAQ
QG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatcgagatcgccggattgcggattgcccgcgagctgcatgagttcgtg
gccagggaagcgctgccgggcacggggatcgaagcggacgccttctggaacggtttttcg
gccatcgtccatgatctggcgccgaagaaccgggagctgctggcaaagcgtgacgccatc
caggaacagatagacggctggtatcgcgatcacggcgcgccggtcgacatggaggcctac
aagggcttcctgaaagggatcggctacctcgttcccgaaggcccggccttcagcgtgtcg
accgacaatgtcgacccggaaattgctgatgttgccggaccgcagctggtcgtgccggtg
atgaatgcgcgctatgcgctcaacgctgccaatgcgcgctggggttcgctctacgatgcg
ctctacggcaccgatgccatccccgaaacggatggcgccgaaaagggcaaagccttcaat
ccggcacgcggcgccaaggtcgtcgcctggacgaagacctttctcgacgaggctgccccg
ctcacgtccggcaaatgggccggcgtcaatggcctgtcgctggcgcaaggtgccttgcgg
ctgagcgccggcgccggctcgacgacgctggccgaccccaggcaattcgtcggctatcgc
ggcgatgccgccaatcccgatgccgtgctgcttgtgcgcaacggcctgcacatcgagatc
gtgatcgaccgcaacaaccagatcggccgcaccgatccggcgggcatcgccgatgtgatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggcggtggatgcg
ccagacaaggtcgtcgtctaccgcaactggctcggcctgatgaagggtgacctggcggaa
gagatcaccaagggcggcaagagttttgtccgcaagctcaatcccgaccgcgcctacacc
gcgcccgccggtggcacgctgaccgtgcccggccgctcgctgatgctggtcaggaatgtc
ggccacctgatgaccagcccggcgatcctcgaccgcgacggcaatgaggttccggaaggc
atcatggatgcggcgatgacggcgctgatcgcgctgcacgatgtcgggccgaacggccgc
cgcgccaattcccgagccggctcgatgtatgtcgtgaaacccaagatgcatgggcccgac
gaagtcgctttcgccgtcgagatgttcgaccgcgtcgaagcgctgctcggcatggcgaaa
aataccatcaagatgggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggag
gcaatccgcgccgcaaaggagcgcgtcgtgttcatcaacaccggctttctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctacgaggcgtggaatgtcgacatcgggctggaatgcggc
ttggccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggctgcg
atgctggtcgagaagatcgcccaccccaaggccggcgccaacactgcctgggtgccgtcg
ccgacggcggcgacgctgcatgccacgcactatcacaaggtcgatgttcacgccgtgcag
gcggcgctgaagaaccggcccaaggccaggctcgacgacatcctgtcggtgcccgtcgcg
gtgcggccgaactggtcgccggatgatatccagaaggaactcgacaacaacgcgcagggc
attcttggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaaagtgcctgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcggatttcctcacagcacatc
gccaactggctgcaccacggcgtgtgcagcgaggaccaggtgatggcgacgatgaagcgc
atggctgacatcgtcgaccgccagaacgagggcgacccgctctacgagccgatggcggcc
gactttgacaagtcgatagccttcctcgccgcctgcgacctggtattcaagggccgcgcc
cagcccaacggctacaccgagccggtgttgcacgcgcggcggctggaactgaaggcgcag
cagggctga

DBGET integrated database retrieval system