KEGG   Mesorhizobium ciceri: Mesci_0739Help
Entry
Mesci_0739        CDS       T01401                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mci  Mesorhizobium ciceri
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_0739
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesci_0739
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_0739
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mesci_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(785220..787388)
Genome map
AA seq 722 aa AA seqDB search
MTDRIEIAGLRIARELHEFVAREALPGTGIEADAFWNGFSAIVHDLAPKNRELLAKRDAI
QEQIDGWYRDHGAPVDMEAYKGFLKGIGYLVPEGPAFSVSTDNVDPEIADVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKAFNPARGAKVVAWTKTFLDEAAP
LTSGKWAGVNGLSLAQGALRLSAGAGSTTLADPRQFVGYRGDAANPDAVLLVRNGLHIEI
VIDRNNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAPDKVVVYRNWLGLMKGDLAE
EITKGGKSFVRKLNPDRAYTAPAGGTLTVPGRSLMLVRNVGHLMTSPAILDRDGNEVPEG
IMDAAMTALIALHDVGPNGRRANSRAGSMYVVKPKMHGPDEVAFAVEMFDRVEALLGMAK
NTIKMGIMDEERRTTVNLKEAIRAAKERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLVEKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKNRPKARLDDILSVPVAVRPNWSPDDIQKELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLHHGVCSEDQVMATMKR
MADIVDRQNEGDPLYEPMAADFDKSIAFLAACDLVFKGRAQPNGYTEPVLHARRLELKAQ
QG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatcgagatcgccggattgcggattgcccgcgagctgcatgagttcgtg
gccagggaagcgctgccgggcacggggatcgaagcggacgccttctggaacggtttttcg
gccatcgtccatgatctggcgccgaagaaccgggagctgctggcaaagcgtgacgccatc
caggaacagatagacggctggtatcgcgatcacggcgcgccggtcgacatggaggcctac
aagggcttcctgaaagggatcggctacctcgttcccgaaggcccggccttcagcgtgtcg
accgacaatgtcgacccggaaattgctgatgttgccggaccgcagctggtcgtgccggtg
atgaatgcgcgctatgcgctcaacgctgccaatgcgcgctggggttcgctctacgatgcg
ctctacggcaccgatgccatccccgaaacggatggcgccgaaaagggcaaagccttcaat
ccggcacgcggcgccaaggtcgtcgcctggacgaagacctttctcgacgaggctgccccg
ctcacgtccggcaaatgggccggcgtcaatggcctgtcgctggcgcaaggtgccttgcgg
ctgagcgccggcgccggctcgacgacgctggccgaccccaggcaattcgtcggctatcgc
ggcgatgccgccaatcccgatgccgtgctgcttgtgcgcaacggcctgcacatcgagatc
gtgatcgaccgcaacaaccagatcggccgcaccgatccggcgggcatcgccgatgtgatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggcggtggatgcg
ccagacaaggtcgtcgtctaccgcaactggctcggcctgatgaagggtgacctggcggaa
gagatcaccaagggcggcaagagttttgtccgcaagctcaatcccgaccgcgcctacacc
gcgcccgccggtggcacgctgaccgtgcccggccgctcgctgatgctggtcaggaatgtc
ggccacctgatgaccagcccggcgatcctcgaccgcgacggcaatgaggttccggaaggc
atcatggatgcggcgatgacggcgctgatcgcgctgcacgatgtcgggccgaacggccgc
cgcgccaattcccgagccggctcgatgtatgtcgtgaaacccaagatgcatgggcccgac
gaagtcgctttcgccgtcgagatgttcgaccgcgtcgaagcgctgctcggcatggcgaaa
aataccatcaagatgggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggag
gcaatccgcgccgcaaaggagcgcgtcgtgttcatcaacaccggctttctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctacgaggcgtggaatgtcgacatcgggctggaatgcggc
ttggccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggctgcg
atgctggtcgagaagatcgcccaccccaaggccggcgccaacactgcctgggtgccgtcg
ccgacggcggcgacgctgcatgccacgcactatcacaaggtcgatgttcacgccgtgcag
gcggcgctgaagaaccggcccaaggccaggctcgacgacatcctgtcggtgcccgtcgcg
gtgcggccgaactggtcgccggatgatatccagaaggaactcgacaacaacgcgcagggc
attcttggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaaagtgcctgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcggatttcctcacagcacatc
gccaactggctgcaccacggcgtgtgcagcgaggaccaggtgatggcgacgatgaagcgc
atggctgacatcgtcgaccgccagaacgagggcgacccgctctacgagccgatggcggcc
gactttgacaagtcgatagccttcctcgccgcctgcgacctggtattcaagggccgcgcc
cagcccaacggctacaccgagccggtgttgcacgcgcggcggctggaactgaaggcgcag
cagggctga

DBGET integrated database retrieval system