KEGG   Mesorhizobium ciceri: Mesci_0961Help
Entry
Mesci_0961        CDS       T01401                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mci  Mesorhizobium ciceri
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mesci_0961
Enzymes [BR:mci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mesci_0961
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mesci_0961
Lipid biosynthesis proteins [BR:mci01004]
 Fatty acid synthase
  Component type
   Mesci_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1011766..1012410)
Genome map
AA seq 214 aa AA seqDB search
MSFKRSIAAGFVVFLAICGVMSSARAEPFKIVGFGDSLMAGYGLGPDQGFTDRLQAALGA
KGHDVTVANAGVSGDTTSGGLARLDWSVPDGTQLVILELGANDMLRGVSPDITKKNLDEM
LSKLKQRKIAVLLAGMRAAPNLGPDYQSAFDAIFPDLAKKYDVALYPFFLDGVAGQPGMQ
LEDGLHPSARGVDQMVERILPAVEKVIAAVPGDS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaacgcagtattgccgcaggcttcgtggttttcctcgccatttgcggcgtc
atgtcgtcggcgcgtgccgagccgttcaagatcgtcggcttcggtgacagcctgatggcg
ggctatggccttggacccgaccagggctttaccgacaggctgcaggcagcgcttggcgcc
aaaggccacgacgtgaccgtcgccaatgccggcgtctccggcgacacgacgagcggcggc
ctggcgcggcttgactggtcggtgccggacggcacgcagctggtcatcctcgaactcggc
gccaacgacatgctgcgcggcgtctcgcccgacatcaccaaaaagaacctcgacgagatg
ctgagcaagctgaagcagcgcaagattgccgtgcttctggccggcatgcgcgccgcaccc
aatctcggtcccgactaccagagcgccttcgacgccattttcccggacctggcgaagaaa
tacgacgtcgcgctctacccgttctttctcgatggcgtcgccggccagcccggcatgcag
ctcgaggacggcctgcatccgagcgcacgaggcgtcgaccagatggtcgaacgcatcctg
cccgctgtcgagaaggtgatcgcggcggtgccgggcgattcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system