KEGG   Mesorhizobium ciceri: Mesci_0988Help
Entry
Mesci_0988        CDS       T01401                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mci  Mesorhizobium ciceri
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_0988
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesci_0988
   00640 Propanoate metabolism
    Mesci_0988
   00660 C5-Branched dibasic acid metabolism
    Mesci_0988
Enzymes [BR:mci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mesci_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1038122..1039315
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKALLKSFGAPVAEGVPVFKASEAEAAAKALPGPLYVVKSQIHAGGRGKGKFT
ELGPDAKGGVRLAKSVADVVANANEMLGNTLVTKQTGPAGKQVNRLYIEDGADIERELYL
SILVDRSVGRIAFVVSTEGGMDIEAVAHDTPEKIITVAIDPEKGVTSADLKALNGALKLD
GDAAKDGDTLFPILYKAFVDKDMSLLEVNPLIVMKNGRLRVLDAKVSFDNNALFRHPDVL
ELRDTTEEDEKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITRDPAVKGILINIFGGIMKCDIIAEGVIAAVKEVGLEVPLVVRLE
GTNAELGKKIINDSGLNVVSADDLDDAAKKIVAAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgagtatcagggcaaggcactgctgaagtcgttcggcgcgccggtggcc
gaaggcgtgccggtgttcaaggcgagcgaagcggaagccgccgccaaggcgctgccgggc
ccgctctatgtggtgaagagccagatccatgccggcggccgcggcaagggcaaattcacc
gagctcggcccggacgccaagggcggcgtgcggctggcgaaatcggtggccgatgtcgtc
gccaacgccaacgagatgctgggcaacactctggtgaccaagcagaccggcccggccggc
aagcaggtcaaccgcctctatatcgaagacggcgccgacatcgaacgcgagctctatctg
tcgatcctggtcgaccgttcggtcggccgcattgcgttcgtcgtctcgaccgaaggcggc
atggacatcgaagcggttgcccatgacacgcccgaaaagatcatcaccgtcgccatcgat
ccggaaaaaggcgtcacatcggccgacctgaaggcgctcaacggcgcgctcaagctcgac
ggcgatgcggccaaggacggcgatacgctgttcccgatcctctacaaggccttcgtcgac
aaggacatgagcctgctcgaggtcaatccgctgatcgtcatgaagaacggccggctgcgc
gtgctcgacgcgaaagtgtcgttcgacaacaacgcgctgttccgccaccccgacgtgctt
gagctgcgcgacaccacggaagaggacgagaaggaaatcgaggcgtcgaaatacgacctc
gcctatgtggcgctcgacggcaatatcggttgcatggtcaacggcgccggcctcgccatg
gcaacgatggacatcatcaagctctatggcgccgagcccgccaacttcctcgatgtcggc
ggtggcgcttcgaaggagaaggtgacggcagcgttcaagatcatcaccagggatcctgcg
gtcaaaggcatcctgatcaacatcttcggcggcatcatgaagtgcgacatcattgccgag
ggcgtcattgccgcggtcaaggaagtcggcctggaagtgccgctggtggtgcgcctggaa
ggcaccaatgccgagctcggcaagaagatcatcaacgacagcggcctcaacgtggtgtct
gccgacgatctcgacgatgcagccaagaagatcgtggcggcggtgaagggctga

DBGET integrated database retrieval system