KEGG   Mesorhizobium ciceri: Mesci_0992Help
Entry
Mesci_0992        CDS       T01401                                 

Definition
2-oxoglutarate dehydrogenase E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mci  Mesorhizobium ciceri
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_0992
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesci_0992
  Amino acid metabolism
   00310 Lysine degradation
    Mesci_0992
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mesci_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1043799..1045073
Genome map
AA seq 424 aa AA seqDB search
MATEIRVPTLGESVTEATVGKWFKKVGDTIAADEPLVELETDKVTVEVPAAAAGTLGEIT
VKEGETVGVGALLGSISAGGAAPATKPQAVSQASSPDAASTGKQAAAETAKIAGDAGPVE
PRTMPPAPAAAKLIAESNLSVDQISGSGKRGQVLKGDVLDAISKGAPSQPAETPKAAPAP
VAVRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMALRTKYK
DVFEKKHGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGVAVGTEKGLVV
PVVRDADQMSIAEIEKDIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMSTPILNAP
QSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL
VLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatccgcgttcccactctcggcgaatccgtcactgaagcgaccgtcggc
aaatggttcaagaaggttggcgatacaatcgccgccgatgaaccgctggtcgagctcgag
accgacaaggtgacggtggaggtgcctgccgccgccgccggcacgctgggtgagatcacc
gtcaaggaaggcgagacggtcggtgtcggcgcgctgctggggtcgatttcggcaggcggc
gcggctcccgccacgaagccgcaagcggtgtcgcaggcctcgtcgccggatgcggcatcg
accggcaagcaggccgcggccgagaccgccaagatcgccggcgatgccggcccggtcgag
ccgcgcaccatgccaccggcaccggccgcggcgaaactgatcgccgaaagcaatctctcg
gtcgaccagatctccggttcgggaaagcgcggccaggtgctgaaaggtgacgtgctcgac
gccatctccaagggcgcgccgtcgcagccggccgagacgccgaaagcagcaccggcaccg
gttgccgtgcgggcgccgtcctcgggcgacgatgcatcgcgcgaggagcgcgtgcgcatg
accaaattgcgccagaccatcgcgcgccgcctcaaggaagcgcagtcgaccgcagccatg
ctgaccaccttcaacgaggtcgacatgtcagcggtgatggcgctgcgcaccaaatacaag
gatgtgttcgagaagaagcacggcgtgaagctcggcttcatgggcttcttcaccaaggcc
gtcacgcacgcgttgaaggaaatcccctcggtcaatgccgagatcgacggcaccgatatc
atcttcaagaactatgcccatatcggcgtcgccgtcggcactgaaaagggcctcgtcgtg
ccggtggtgcgcgatgccgaccagatgtcgatcgccgagatcgagaaggacatcggccgg
ctgggtatcgccgcgcgtgacggaaagctgtcggtcgccgacatgcagggcggcacgttt
acgatttcgaacggcggcgtttacgggtcgctgatgtcgaccccgatcctcaacgcgccg
cagtcgggcattctcggcatgcacaagatccaggaccggcctgtcgtggtcggcggccag
atcgtcatccggccgatgatgtacctggcgctcagctacgatcatcgcatcgtcgacggc
aaggaagcggtgacgttcctggtgcgcgtcaaggaaagcctggaggatccggaacggctg
gtgcttgatctctga

DBGET integrated database retrieval system