KEGG   Mesorhizobium ciceri: Mesci_0992Help
Entry
Mesci_0992        CDS       T01401                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00020  Citrate cycle (TCA cycle)
mci00310  Lysine degradation
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
Module
mci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesci_0992
  Amino acid metabolism
   00310 Lysine degradation
    Mesci_0992
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mesci_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 10116438
NCBI-ProteinID: YP_004140206
UniProt: E8TIW0
Position
1043799..1045073
Genome map
AA seq 424 aa AA seqDB search
MATEIRVPTLGESVTEATVGKWFKKVGDTIAADEPLVELETDKVTVEVPAAAAGTLGEIT
VKEGETVGVGALLGSISAGGAAPATKPQAVSQASSPDAASTGKQAAAETAKIAGDAGPVE
PRTMPPAPAAAKLIAESNLSVDQISGSGKRGQVLKGDVLDAISKGAPSQPAETPKAAPAP
VAVRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMALRTKYK
DVFEKKHGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGVAVGTEKGLVV
PVVRDADQMSIAEIEKDIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMSTPILNAP
QSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL
VLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatccgcgttcccactctcggcgaatccgtcactgaagcgaccgtcggc
aaatggttcaagaaggttggcgatacaatcgccgccgatgaaccgctggtcgagctcgag
accgacaaggtgacggtggaggtgcctgccgccgccgccggcacgctgggtgagatcacc
gtcaaggaaggcgagacggtcggtgtcggcgcgctgctggggtcgatttcggcaggcggc
gcggctcccgccacgaagccgcaagcggtgtcgcaggcctcgtcgccggatgcggcatcg
accggcaagcaggccgcggccgagaccgccaagatcgccggcgatgccggcccggtcgag
ccgcgcaccatgccaccggcaccggccgcggcgaaactgatcgccgaaagcaatctctcg
gtcgaccagatctccggttcgggaaagcgcggccaggtgctgaaaggtgacgtgctcgac
gccatctccaagggcgcgccgtcgcagccggccgagacgccgaaagcagcaccggcaccg
gttgccgtgcgggcgccgtcctcgggcgacgatgcatcgcgcgaggagcgcgtgcgcatg
accaaattgcgccagaccatcgcgcgccgcctcaaggaagcgcagtcgaccgcagccatg
ctgaccaccttcaacgaggtcgacatgtcagcggtgatggcgctgcgcaccaaatacaag
gatgtgttcgagaagaagcacggcgtgaagctcggcttcatgggcttcttcaccaaggcc
gtcacgcacgcgttgaaggaaatcccctcggtcaatgccgagatcgacggcaccgatatc
atcttcaagaactatgcccatatcggcgtcgccgtcggcactgaaaagggcctcgtcgtg
ccggtggtgcgcgatgccgaccagatgtcgatcgccgagatcgagaaggacatcggccgg
ctgggtatcgccgcgcgtgacggaaagctgtcggtcgccgacatgcagggcggcacgttt
acgatttcgaacggcggcgtttacgggtcgctgatgtcgaccccgatcctcaacgcgccg
cagtcgggcattctcggcatgcacaagatccaggaccggcctgtcgtggtcggcggccag
atcgtcatccggccgatgatgtacctggcgctcagctacgatcatcgcatcgtcgacggc
aaggaagcggtgacgttcctggtgcgcgtcaaggaaagcctggaggatccggaacggctg
gtgcttgatctctga

DBGET integrated database retrieval system