KEGG   Mesorhizobium ciceri: Mesci_1050Help
Entry
Mesci_1050        CDS       T01401                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mci  Mesorhizobium ciceri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mci00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1092901..1093617
Genome map
AA seq 238 aa AA seqDB search
MLRVLVTRPEPGASRTAHRLEEAGFQPVLLPLTETKALPAAAGLIPDDAVAVAVTSANAM
RHAPEEIIGTLAALPCHAVGRRTAEAARKAGFLSVSEGPGDAEALADVLAADFSGKTIVY
LCGRVRFPAFEQRLGTAGVRVDAVETYDTLTVGYPDEVILKRLSGQPADAVLLYSAKAAA
AMQMLARRPALRGLFEKTWVFALSARIAAAFDDATGERIRIAAQPDEEALLALLQAPR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcgtcctggtgaccaggccggaaccgggtgcttcgcgcacagcgcatcggctg
gaggaggcaggtttccagccggttcttttgcccctgaccgaaacaaaggcgttgcccgcc
gctgccggactgatcccggacgatgccgtcgcggtggccgtcacaagcgccaatgccatg
cgccatgcgccggaagaaatcatcgggacgctcgccgccttgccttgtcatgccgtcggt
aggcggactgcggaagctgcccgcaaagcggggtttttgtcggtcagtgaaggcccgggc
gatgcagaggcgctggccgacgttctcgccgccgatttttctggaaagacgattgtctac
ctgtgtgggcgcgtgcgttttccggcgttcgaacagaggctcgggacggcgggcgttcgg
gtcgacgccgtcgagacctatgacacgctgacagtaggttatccggacgaagtcatcctc
aaacgcctgtcggggcaacctgccgacgcggtattgctctattcagccaaggcggcggcg
gcgatgcagatgttggcaagacggcccgctctgcgcggtctcttcgaaaaaacatgggtt
tttgcgctttccgctcgcatcgccgcagccttcgacgatgccaccggcgaaaggatccgc
attgccgcgcaacctgacgaggaggcattgctggcgcttttgcaggcgccgcgctga

DBGET integrated database retrieval system