KEGG   Mesorhizobium ciceri: Mesci_1059Help
Entry
Mesci_1059        CDS       T01401                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_1059
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_1059
   00520 Amino sugar and nucleotide sugar metabolism
    Mesci_1059
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mesci_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1101922..1102641)
Genome map
AA seq 239 aa AA seqDB search
MAKAVKQPASGTETPDAEKIVLTIDIGGSHVKILTSAGGAERRADSGPGLTPQQMIDTVK
KLAEGLSYDVVSMGYPGPVNHNRPLADPANLGKGWAGFDFAGAFGKPVKVVNDALMQAIG
SYEGGRMLFLGLGTGLGAAMIADNVAQPMELAHLPYKKGKSFEDYVGERGLEKRGKKKWR
KYVFDVVDRLRAAMQPDYVVIGGGNVDKLDELPADSRRGDNTRAFEGGFRLWRDKALIV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcagtgaagcaaccagcatcgggcaccgagacgccagatgctgaaaagatc
gtgctcacgatcgacatcggcggctcgcacgtcaagatcctcaccagcgccggcggcgcg
gagcgccgcgccgattcggggccggggctgacgccgcaacagatgatcgataccgtgaag
aagctcgccgaaggcctgtcctacgacgtcgtctcgatgggctatcccggtccggtcaac
cacaacaggccgctcgccgaccccgccaatctcggcaagggctgggctggattcgacttt
gcgggcgcgttcggcaaaccggtgaaagtggtcaatgacgcgctgatgcaggccatcggc
agctacgagggcgggcgcatgctgttcctcgggctcggcaccgggctcggtgcggcgatg
attgccgacaacgtcgcccaaccgatggaactcgcgcatctgccctacaagaagggcaag
agcttcgaggattatgtcggcgaacgcggcctggaaaagcgcggcaagaagaaatggcgc
aaatacgtcttcgacgtcgtcgaccggctccgtgccgccatgcagcctgactatgtcgtc
attggcggcggcaacgtcgacaagctcgatgaattgcccgccgactccaggcgcggcgac
aacacacgcgccttcgaaggcgggtttcgtttgtggcgcgacaaagcgctgatagtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system