KEGG   Mesorhizobium ciceri: Mesci_1142Help
Entry
Mesci_1142        CDS       T01401                                 

Definition
secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesci_1142
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mesci_1142
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesci_1142
Enzymes [BR:mci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mesci_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1186138..1187712
Genome map
AA seq 524 aa AA seqDB search
MNKLSMTRRAFVTSASAVGLAGVSSLALPYYSRASQRPAFTHGVQSGDVDATSGMVWTRT
DRPSRVMFEVSSTENFATATRLAPLDTSPASDYTVKRLLTDLASDQDIFYRMTAADLADI
NAVSEPITGRFRTAPASKRDIRFAWSGDTAGQGWGIDETGMKTYATIGKHTPDFFLHSGD
TIYADGAMKDEVDLPGGGKWKNVVLIDGKRKVAETLDEYRDQWKYNMMDRNVLGLSAICP
TFYQWDDHEVLNNWSDSKDLSADSRYTEKSIHVLAARAARAFHEMTTIRYEPSEPGRVYR
KIAYGPLLDVFFLDMRSYRGPNGPDMQDEMTPQSRMLGEQQTKWLKRELANSKATWKIIA
ADMPLGLVVWDDGTKKVGAEAVSNGDNGLPKGRELEIADLLRFIKNAGISNTVWLTADVH
YTAAHYYSPDKAQFQDFNPFWEFVSGPIHAGTFGPNDFDMTFGPELKFIKAPTAEQGQNL
PPSAGLQFFGLVDISGASEQMTVRLMDRDDNELYKVTLDPVRSA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagctttcgatgactcgccgcgctttcgtcacctccgccagcgccgttggcctg
gctggcgtctcgagcctggcgctgccttactattcgcgcgccagtcagcggccggccttc
acccatggcgtccagtccggcgatgtcgacgcaaccagcggcatggtgtggacgcgcacc
gatcgcccgtcgcgcgtcatgttcgaagtgtcgtcgacggagaatttcgccactgcgaca
cgcctggcgccgctcgatacgtcgccggccagcgactacaccgtcaagcggctgctcacc
gacctcgcttcggaccaggatatcttctatcgcatgacggcagccgatctcgccgacatc
aacgccgtttccgagccgatcaccgggcgcttcaggacggcgccggcctcgaagcgcgac
atccgctttgcctggtcgggcgacaccgccggccagggctggggcatcgatgagaccggc
atgaagacctacgccacgatcggcaagcacacgcccgacttcttcctgcattcgggcgac
accatctatgccgacggcgccatgaaggacgaggtcgacctgcccggcggcggcaagtgg
aagaacgtcgtgctgatcgacggcaagcgcaaggttgccgagacgctggacgaataccgg
gaccagtggaagtacaacatgatggacaggaacgtgctcggcctcagcgccatctgcccg
actttctaccagtgggacgaccatgaagtcctgaacaactggtcggattcgaaggatctc
agcgccgacagccgctatacggaaaaatccatccacgtgctggcggcccgtgcggcgcgg
gctttccacgagatgacgacgatccgctacgaaccttccgagcccggccgcgtgtatcgc
aagatcgcctacgggccgctgctcgacgtgttcttcctcgacatgcgctcctatcgcggc
cccaatggtcccgacatgcaggatgagatgacgccgcaatcgcgcatgctcggcgaacag
cagacgaaatggctgaagcgcgaactggcgaattcgaaggcgacctggaaaatcatcgcc
gccgacatgccgctcggcctcgtcgtctgggacgacggcaccaagaaggttggtgccgaa
gcagtcagcaatggcgacaatggcttgccaaaagggcgtgagctcgagatcgccgacctg
ctgcgcttcatcaagaatgccggcatcagcaacaccgtctggctcaccgccgacgtgcat
tacacggccgcgcattattacagcccggacaaggcgcagttccaggatttcaatccgttc
tgggaattcgtttcgggtccgatccatgccggaacattcgggccgaacgatttcgacatg
acgttcggtccggagctgaagttcatcaaggcgccgaccgccgaacagggacagaacctg
ccgccctcggcaggtctgcaattcttcgggctggtcgatatttcaggcgccagcgagcag
atgacggtgcggctgatggatcgcgacgacaatgaactctacaaggtgacgctcgacccg
gtacggtcggcataa

DBGET integrated database retrieval system