KEGG   Mesorhizobium ciceri: Mesci_1333Help
Entry
Mesci_1333        CDS       T01401                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mci  Mesorhizobium ciceri
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mesci_1333
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mesci_1333
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mesci_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1393157..1393939
Genome map
AA seq 260 aa AA seqDB search
MAARKTAVITGSTSGIGLAIAQALAAEGHNVVVNSFSDTAADHAVADAIARQHKAKTAYI
KADMSKPAECRALIAKAAETFGSVDILVNNAGIQHVAPVEEFPIEKWDAIIAINLSSAFH
TIAAAIPLMKKAGGGRIVNIASAHGLVASPFKSAYVSAKHGIMGLTKTVALELAREKITC
NAICPGYVLTPLVEAQIPDQMKAHQMDRETVIREVMLDKQPTKEFVTVEQIAAAAVFLCS
DTAAQVNGTHLSVDGGWTAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttggccgccagaaaaaccgcagtcatcaccggctccacatcgggcattggcctggccatc
gcccaggcgctggcggccgaaggccataatgtcgtcgtcaactccttctccgacacggct
gccgaccacgccgtcgctgacgcgatcgccagacagcacaaggcgaagacggcctatatc
aaggccgacatgtcgaagccggccgaatgccgggcgctgatcgccaaggcggccgagaca
ttcggttcggtcgatattctcgtcaacaatgcaggcatccagcatgtcgcgccggtggaa
gagttcccgatcgagaaatgggacgccatcattgccatcaacctgtcgtcggcgttccac
accatcgcggccgccatcccgctgatgaaaaaggccggcggcggccggatcgtcaacatc
gcctcggcgcatggcctggtcgcgtcgccgttcaaatcggcctatgtctcggccaagcac
ggcatcatgggattgaccaaaaccgttgcgctcgaactggcgcgcgaaaaaatcacctgc
aacgccatctgccccggctatgtgctgacgccgctggtcgaggcgcagatccccgaccag
atgaaagcccatcagatggaccgcgagaccgtcatccgtgaggtcatgctggacaagcag
ccgaccaaggaattcgtcacggtggagcagatcgcggcagcggcggtgttcctgtgctcg
gacacggcagcgcaggtcaacggcacgcatctctcggtcgacggcggctggaccgccgcg
tga

DBGET integrated database retrieval system