KEGG   Mesorhizobium ciceri: Mesci_1461Help
Entry
Mesci_1461        CDS       T01401                                 

Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00072  Synthesis and degradation of ketone bodies
mci00650  Butanoate metabolism
mci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mesci_1461
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mesci_1461
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mesci_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Eno-Rase_NADH_b LT-IIB
Motif
Other DBs
NCBI-GeneID: 10116911
NCBI-ProteinID: YP_004140670
UniProt: E8T8G4
Position
1516702..1517490
Genome map
AA seq 262 aa AA seqDB search
MGFLSSKNALVTGSTSGIGLAIARAFAAEGANVTINGLGDAAAIEQERTGIERDFGVKCR
YSGANMMDGAAVSAMVHEAEAAFGSLDILVNNAGIQHVAPIEEFPDDKWEAIIRINLLAA
FYAIKAALPGMKTRKWGRIINTASAHALVASPFKSAYVSAKHGIAGLTKTVALEAALDGV
TVNAIAPGYVWTPLVERQIPDTMKARGMTEEQVKHDVLLAAQPTKEFVTVDELAALTLFL
CSDAARQVTGTTLPMDGGWTAQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcctgtcttcgaagaacgccctcgtcaccggctcgaccagcggcatcggcctg
gccatcgcccgcgcctttgccgccgaaggcgccaatgtcaccatcaacggccttggcgat
gcggctgccatcgagcaggagcgcaccggcatcgagagggatttcggcgtcaagtgccgc
tattccggtgccaacatgatggatggcgcggcggtcagcgccatggtgcatgaggccgag
gctgccttcggcagtctcgatatcctggtcaacaatgccggcatccagcatgtcgcgccg
atcgaggagtttcccgatgacaagtgggaagccatcatccgcatcaatctgctcgccgcg
ttctacgccatcaaggcggcactgccgggcatgaagacgcgcaaatggggccgtatcatc
aacaccgcctcggcgcatgcgctggtcgcctcgccgttcaagtcggcctatgtgtcggcc
aagcacggcattgcgggcctcaccaagacggtagcgctcgaagcagcgctcgacggcgtc
accgtcaatgcgatcgcgccgggctatgtctggacgccgctggtcgaaaggcagattccc
gacacgatgaaggcgcgcggcatgaccgaggaacaggtcaagcacgatgtgctgctcgcc
gcccagccgaccaaggaattcgtcaccgtcgacgagctcgccgcgctgacgctgttcctg
tgttcggacgcggccaggcaggtcaccggcaccaccttgccgatggatggcggctggacg
gcacagtag

DBGET integrated database retrieval system